BLASTX nr result
ID: Coptis24_contig00004900
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00004900 (574 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_177135.1| DNA (cytosine-5)-methyltransferase CMT3 [Arabid... 62 3e-08 dbj|BAF01425.1| putative chromomethylase [Arabidopsis thaliana] 62 3e-08 gb|AAK71870.1| chromomethylase 3 [Arabidopsis thaliana] 62 3e-08 gb|AAK69756.1|AF383170_1 chromomethylase CMT3 [Arabidopsis thali... 62 3e-08 emb|CAQ18903.1| chromomethylase [Nicotiana sylvestris] gi|169977... 59 3e-07 >ref|NP_177135.1| DNA (cytosine-5)-methyltransferase CMT3 [Arabidopsis thaliana] gi|110832800|sp|Q94F88.2|CMT3_ARATH RecName: Full=DNA (cytosine-5)-methyltransferase CMT3; AltName: Full=Chromomethylase 3; AltName: Full=Protein CHROMOMETHYLASE 3 gi|12325192|gb|AAG52543.1|AC013289_10 putative chromomethylase; 17383-22406 [Arabidopsis thaliana] gi|332196852|gb|AEE34973.1| DNA (cytosine-5)-methyltransferase CMT3 [Arabidopsis thaliana] Length = 839 Score = 61.6 bits (148), Expect(2) = 3e-08 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = -3 Query: 92 CRPFRRLWWDVIVPIVVTRAEPHNQIILHP 3 C+PF RLWWD IVP VVTRAEPHNQ+I+HP Sbjct: 727 CKPFGRLWWDEIVPTVVTRAEPHNQVIIHP 756 Score = 21.6 bits (44), Expect(2) = 3e-08 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = -2 Query: 216 VPDYAVTFKDVFSKECR 166 VPDYA+T+ D K C+ Sbjct: 714 VPDYALTYVD--GKSCK 728 >dbj|BAF01425.1| putative chromomethylase [Arabidopsis thaliana] Length = 839 Score = 61.6 bits (148), Expect(2) = 3e-08 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = -3 Query: 92 CRPFRRLWWDVIVPIVVTRAEPHNQIILHP 3 C+PF RLWWD IVP VVTRAEPHNQ+I+HP Sbjct: 727 CKPFGRLWWDEIVPTVVTRAEPHNQVIIHP 756 Score = 21.6 bits (44), Expect(2) = 3e-08 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = -2 Query: 216 VPDYAVTFKDVFSKECR 166 VPDYA+T+ D K C+ Sbjct: 714 VPDYALTYVD--GKSCK 728 >gb|AAK71870.1| chromomethylase 3 [Arabidopsis thaliana] Length = 839 Score = 61.6 bits (148), Expect(2) = 3e-08 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = -3 Query: 92 CRPFRRLWWDVIVPIVVTRAEPHNQIILHP 3 C+PF RLWWD IVP VVTRAEPHNQ+I+HP Sbjct: 727 CKPFGRLWWDEIVPTVVTRAEPHNQVIIHP 756 Score = 21.6 bits (44), Expect(2) = 3e-08 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = -2 Query: 216 VPDYAVTFKDVFSKECR 166 VPDYA+T+ D K C+ Sbjct: 714 VPDYALTYVD--GKSCK 728 >gb|AAK69756.1|AF383170_1 chromomethylase CMT3 [Arabidopsis thaliana] Length = 839 Score = 61.6 bits (148), Expect(2) = 3e-08 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = -3 Query: 92 CRPFRRLWWDVIVPIVVTRAEPHNQIILHP 3 C+PF RLWWD IVP VVTRAEPHNQ+I+HP Sbjct: 727 CKPFGRLWWDEIVPTVVTRAEPHNQVIIHP 756 Score = 21.6 bits (44), Expect(2) = 3e-08 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = -2 Query: 216 VPDYAVTFKDVFSKECR 166 VPDYA+T+ D K C+ Sbjct: 714 VPDYALTYVD--GKSCK 728 >emb|CAQ18903.1| chromomethylase [Nicotiana sylvestris] gi|169977314|emb|CAQ18904.1| chromomethylase [Nicotiana sylvestris] gi|169977316|emb|CAQ18905.1| chromomethylase [Nicotiana sylvestris] gi|169977318|emb|CAQ18906.1| chromomethylase [Nicotiana sylvestris] Length = 741 Score = 58.9 bits (141), Expect(2) = 3e-07 Identities = 24/29 (82%), Positives = 26/29 (89%) Frame = -3 Query: 89 RPFRRLWWDVIVPIVVTRAEPHNQIILHP 3 +PF RLWWD IVP VVTRAEPHNQ+ILHP Sbjct: 629 KPFGRLWWDEIVPTVVTRAEPHNQVILHP 657 Score = 20.8 bits (42), Expect(2) = 3e-07 Identities = 7/8 (87%), Positives = 8/8 (100%) Frame = -2 Query: 216 VPDYAVTF 193 VPDYA+TF Sbjct: 615 VPDYAITF 622