BLASTX nr result
ID: Coptis24_contig00004880
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00004880 (385 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002270846.1| PREDICTED: uncharacterized protein LOC100262... 54 4e-07 emb|CAN64440.1| hypothetical protein VITISV_017550 [Vitis vinifera] 54 4e-07 ref|NP_197695.1| uncharacterized protein [Arabidopsis thaliana] ... 50 2e-06 ref|XP_004138201.1| PREDICTED: uncharacterized protein LOC101209... 50 4e-06 ref|XP_002874108.1| hypothetical protein ARALYDRAFT_489157 [Arab... 48 8e-06 >ref|XP_002270846.1| PREDICTED: uncharacterized protein LOC100262799 [Vitis vinifera] gi|297734138|emb|CBI15385.3| unnamed protein product [Vitis vinifera] Length = 252 Score = 53.9 bits (128), Expect(2) = 4e-07 Identities = 26/35 (74%), Positives = 29/35 (82%), Gaps = 3/35 (8%) Frame = +2 Query: 5 GWICGSFLVP---SVLLQPTWTLELLTSLVACVLI 100 GW+CGSFLVP S LL+PTWTLELLTSLVA V + Sbjct: 210 GWVCGSFLVPMIPSFLLRPTWTLELLTSLVAYVFL 244 Score = 25.0 bits (53), Expect(2) = 4e-07 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = +3 Query: 90 VFLFLSCTFLK 122 VFLFL CTFLK Sbjct: 242 VFLFLGCTFLK 252 >emb|CAN64440.1| hypothetical protein VITISV_017550 [Vitis vinifera] Length = 235 Score = 53.9 bits (128), Expect(2) = 4e-07 Identities = 26/35 (74%), Positives = 29/35 (82%), Gaps = 3/35 (8%) Frame = +2 Query: 5 GWICGSFLVP---SVLLQPTWTLELLTSLVACVLI 100 GW+CGSFLVP S LL+PTWTLELLTSLVA V + Sbjct: 193 GWVCGSFLVPMIPSFLLRPTWTLELLTSLVAYVFL 227 Score = 25.0 bits (53), Expect(2) = 4e-07 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = +3 Query: 90 VFLFLSCTFLK 122 VFLFL CTFLK Sbjct: 225 VFLFLGCTFLK 235 >ref|NP_197695.1| uncharacterized protein [Arabidopsis thaliana] gi|9759362|dbj|BAB09821.1| unnamed protein product [Arabidopsis thaliana] gi|21928168|gb|AAM78111.1| AT5g23040/MYJ24_3 [Arabidopsis thaliana] gi|23505829|gb|AAN28774.1| At5g23040/MYJ24_3 [Arabidopsis thaliana] gi|62392260|dbj|BAD95465.1| cell growth defect factor [Arabidopsis thaliana] gi|332005729|gb|AED93112.1| uncharacterized protein [Arabidopsis thaliana] Length = 258 Score = 49.7 bits (117), Expect(2) = 2e-06 Identities = 22/35 (62%), Positives = 27/35 (77%), Gaps = 3/35 (8%) Frame = +2 Query: 5 GWICGSFLVPSV---LLQPTWTLELLTSLVACVLI 100 GW CGS ++P + L+QPTWTLELLTSLVA V + Sbjct: 216 GWFCGSLIIPMIPTFLIQPTWTLELLTSLVAYVFL 250 Score = 26.6 bits (57), Expect(2) = 2e-06 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +3 Query: 90 VFLFLSCTFLK 122 VFLFLSCTFLK Sbjct: 248 VFLFLSCTFLK 258 >ref|XP_004138201.1| PREDICTED: uncharacterized protein LOC101209271 [Cucumis sativus] gi|449525099|ref|XP_004169557.1| PREDICTED: uncharacterized protein LOC101226625 [Cucumis sativus] Length = 251 Score = 50.4 bits (119), Expect(2) = 4e-06 Identities = 23/31 (74%), Positives = 27/31 (87%), Gaps = 3/31 (9%) Frame = +2 Query: 2 VGWICGSFLVPSV---LLQPTWTLELLTSLV 85 VGW+CGS +VPS+ LLQPTW+LELLTSLV Sbjct: 208 VGWVCGSLVVPSIPSFLLQPTWSLELLTSLV 238 Score = 25.0 bits (53), Expect(2) = 4e-06 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +3 Query: 93 FLFLSCTFLK 122 FLFLSCTFLK Sbjct: 242 FLFLSCTFLK 251 >ref|XP_002874108.1| hypothetical protein ARALYDRAFT_489157 [Arabidopsis lyrata subsp. lyrata] gi|297319945|gb|EFH50367.1| hypothetical protein ARALYDRAFT_489157 [Arabidopsis lyrata subsp. lyrata] Length = 258 Score = 47.8 bits (112), Expect(2) = 8e-06 Identities = 21/35 (60%), Positives = 26/35 (74%), Gaps = 3/35 (8%) Frame = +2 Query: 5 GWICGSFLVPSV---LLQPTWTLELLTSLVACVLI 100 GW CGS ++P + L+ PTWTLELLTSLVA V + Sbjct: 216 GWFCGSIIIPMIPTFLIHPTWTLELLTSLVAYVFL 250 Score = 26.6 bits (57), Expect(2) = 8e-06 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +3 Query: 90 VFLFLSCTFLK 122 VFLFLSCTFLK Sbjct: 248 VFLFLSCTFLK 258