BLASTX nr result
ID: Coptis24_contig00004676
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00004676 (386 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI30029.3| unnamed protein product [Vitis vinifera] 61 8e-08 >emb|CBI30029.3| unnamed protein product [Vitis vinifera] Length = 1695 Score = 61.2 bits (147), Expect = 8e-08 Identities = 36/73 (49%), Positives = 46/73 (63%), Gaps = 1/73 (1%) Frame = -3 Query: 384 VTLELLADKEDFGTPMPSTVNLSIFGSDPPLPTDSN-GGVLLLDSSWNATENCFRVASNA 208 + LE+ D D P+PS +NLSI GS+PP ++ +L SS + EN FR AS A Sbjct: 1501 IRLEIERDFCDSMIPLPSVINLSILGSEPPSAVNNPIEESQILKSSQDMAENRFRAASRA 1560 Query: 207 CFDGQSLDWASSA 169 CFDG +LDWASSA Sbjct: 1561 CFDG-TLDWASSA 1572