BLASTX nr result
ID: Coptis24_contig00004587
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00004587 (351 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002307540.1| predicted protein [Populus trichocarpa] gi|2... 58 7e-07 >ref|XP_002307540.1| predicted protein [Populus trichocarpa] gi|222856989|gb|EEE94536.1| predicted protein [Populus trichocarpa] Length = 225 Score = 58.2 bits (139), Expect = 7e-07 Identities = 25/38 (65%), Positives = 30/38 (78%) Frame = +2 Query: 2 VRKLEASLANYWNRRGMKPVCHSLLSEDVHCVKVPPPL 115 VRKLE SL NYW +RGMKP+ H+LL + + CVK PPPL Sbjct: 188 VRKLEMSLMNYWLKRGMKPISHNLLPDAMECVKDPPPL 225