BLASTX nr result
ID: Coptis24_contig00004272
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00004272 (747 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAD31844.1| putative epsilon subunit of mitochondrial F1-ATP... 114 2e-23 gb|ACS83605.1| ATP synthase epsilon subunit 1 [Gossypium hirsutum] 113 5e-23 ref|XP_002517228.1| ATP synthase epsilon chain, mitochondrial, p... 111 1e-22 ref|XP_002274249.1| PREDICTED: ATP synthase subunit epsilon, mit... 111 1e-22 ref|NP_175576.1| ATP synthase subunit epsilon [Arabidopsis thali... 110 2e-22 >emb|CAD31844.1| putative epsilon subunit of mitochondrial F1-ATPase [Cicer arietinum] Length = 68 Score = 114 bits (285), Expect = 2e-23 Identities = 50/60 (83%), Positives = 57/60 (95%) Frame = -1 Query: 747 PFWRAAGMTYISYSNICASLVRNCLKEPHKSEAINREKVHFSVSKWSDGVAEKPTLRSDD 568 PFWRAAGMTYI+YSNICA+LVRNCLKEPHK+E ++REKVHFS+SKW DG A+KPTLRSDD Sbjct: 8 PFWRAAGMTYITYSNICANLVRNCLKEPHKTEVLSREKVHFSLSKWVDGKAQKPTLRSDD 67 >gb|ACS83605.1| ATP synthase epsilon subunit 1 [Gossypium hirsutum] Length = 70 Score = 113 bits (282), Expect = 5e-23 Identities = 49/63 (77%), Positives = 58/63 (92%) Frame = -1 Query: 747 PFWRAAGMTYISYSNICASLVRNCLKEPHKSEAINREKVHFSVSKWSDGVAEKPTLRSDD 568 PFWRAAGMTYI+YSNICA+LVRNCLKEP+K+EA++REKVHFS+SKW+DG EKPT+RSD Sbjct: 8 PFWRAAGMTYITYSNICANLVRNCLKEPYKTEALSREKVHFSISKWTDGKPEKPTIRSDS 67 Query: 567 TSE 559 E Sbjct: 68 PEE 70 >ref|XP_002517228.1| ATP synthase epsilon chain, mitochondrial, putative [Ricinus communis] gi|223543599|gb|EEF45128.1| ATP synthase epsilon chain, mitochondrial, putative [Ricinus communis] Length = 70 Score = 111 bits (278), Expect = 1e-22 Identities = 49/59 (83%), Positives = 55/59 (93%) Frame = -1 Query: 747 PFWRAAGMTYISYSNICASLVRNCLKEPHKSEAINREKVHFSVSKWSDGVAEKPTLRSD 571 PFWRAAGMTYI+YSNICA+LVRNCLKEPHK+EA+ REKVHFSVSKW DG +KPT+RSD Sbjct: 8 PFWRAAGMTYITYSNICANLVRNCLKEPHKTEALTREKVHFSVSKWVDGKPQKPTMRSD 66 >ref|XP_002274249.1| PREDICTED: ATP synthase subunit epsilon, mitochondrial isoform 1 [Vitis vinifera] Length = 75 Score = 111 bits (278), Expect = 1e-22 Identities = 49/63 (77%), Positives = 56/63 (88%) Frame = -1 Query: 747 PFWRAAGMTYISYSNICASLVRNCLKEPHKSEAINREKVHFSVSKWSDGVAEKPTLRSDD 568 PFWRAAGMTYISYSNICA++VRNCLKEP KSEA+ REKVHFS+SKW +GV +KPT+RSD Sbjct: 12 PFWRAAGMTYISYSNICANMVRNCLKEPFKSEALTREKVHFSISKWDNGVPQKPTIRSDT 71 Query: 567 TSE 559 E Sbjct: 72 PEE 74 >ref|NP_175576.1| ATP synthase subunit epsilon [Arabidopsis thaliana] gi|2493052|sp|Q96253.3|ATP5E_ARATH RecName: Full=ATP synthase subunit epsilon, mitochondrial; Short=ATPase subunit epsilon gi|12321688|gb|AAG50890.1|AC025294_28 epsilon subunit of mitochondrial F1-ATPase [Arabidopsis thaliana] gi|1655486|dbj|BAA13602.1| epsilon subunit of mitochondrial F1-ATPase [Arabidopsis thaliana] gi|18252167|gb|AAL61916.1| epsilon subunit of mitochondrial F1-ATPase [Arabidopsis thaliana] gi|21386911|gb|AAM47859.1| epsilon subunit of mitochondrial F1-ATPase [Arabidopsis thaliana] gi|332194574|gb|AEE32695.1| ATP synthase subunit epsilon [Arabidopsis thaliana] Length = 70 Score = 110 bits (276), Expect = 2e-22 Identities = 48/59 (81%), Positives = 55/59 (93%) Frame = -1 Query: 747 PFWRAAGMTYISYSNICASLVRNCLKEPHKSEAINREKVHFSVSKWSDGVAEKPTLRSD 571 PFWRAAGMTYISYSNICA++VRNCLKEPHK+EA+ REKVHFS+SKW+DG +KP LRSD Sbjct: 8 PFWRAAGMTYISYSNICANIVRNCLKEPHKAEALTREKVHFSLSKWADGKPQKPVLRSD 66