BLASTX nr result
ID: Coptis24_contig00003988
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00003988 (1712 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002282199.2| PREDICTED: cyclin-dependent kinase inhibitor... 103 1e-19 emb|CBI21439.3| unnamed protein product [Vitis vinifera] 103 1e-19 ref|XP_002518785.1| conserved hypothetical protein [Ricinus comm... 92 4e-16 ref|XP_002523560.1| conserved hypothetical protein [Ricinus comm... 91 7e-16 ref|NP_001238139.1| cyclin-dependent kinase inhibitor 1;2 [Glyci... 89 5e-15 >ref|XP_002282199.2| PREDICTED: cyclin-dependent kinase inhibitor 1-like [Vitis vinifera] Length = 227 Score = 103 bits (258), Expect = 1e-19 Identities = 51/82 (62%), Positives = 66/82 (80%), Gaps = 1/82 (1%) Frame = -1 Query: 1517 RREKTPSSSLRQESDEQESMERPTSVS-RHRSMSEMKTPSEAEIDEFFSTAEKDEQRRFT 1341 RRE TPSS LR ESD+ ES RP+ + RHRS E K PSE+E++EFF+ AEKD Q+RF+ Sbjct: 145 RRETTPSSELRAESDDLESTARPSEANYRHRSTVE-KMPSESELEEFFAAAEKDVQKRFS 203 Query: 1340 DKFNFDIRKDLPLKGRYEWVRL 1275 +K+N+DI KD+P++GRYEWVRL Sbjct: 204 EKYNYDIVKDVPMEGRYEWVRL 225 >emb|CBI21439.3| unnamed protein product [Vitis vinifera] Length = 212 Score = 103 bits (258), Expect = 1e-19 Identities = 51/82 (62%), Positives = 66/82 (80%), Gaps = 1/82 (1%) Frame = -1 Query: 1517 RREKTPSSSLRQESDEQESMERPTSVS-RHRSMSEMKTPSEAEIDEFFSTAEKDEQRRFT 1341 RRE TPSS LR ESD+ ES RP+ + RHRS E K PSE+E++EFF+ AEKD Q+RF+ Sbjct: 130 RRETTPSSELRAESDDLESTARPSEANYRHRSTVE-KMPSESELEEFFAAAEKDVQKRFS 188 Query: 1340 DKFNFDIRKDLPLKGRYEWVRL 1275 +K+N+DI KD+P++GRYEWVRL Sbjct: 189 EKYNYDIVKDVPMEGRYEWVRL 210 >ref|XP_002518785.1| conserved hypothetical protein [Ricinus communis] gi|223542166|gb|EEF43710.1| conserved hypothetical protein [Ricinus communis] Length = 202 Score = 92.0 bits (227), Expect = 4e-16 Identities = 45/82 (54%), Positives = 56/82 (68%) Frame = -1 Query: 1520 FRREKTPSSSLRQESDEQESMERPTSVSRHRSMSEMKTPSEAEIDEFFSTAEKDEQRRFT 1341 F RE +PSSS ++DE ES R + K PS+ EIDEFF+ AEK EQ+RF Sbjct: 119 FSRETSPSSSFYGDTDEMESPAPVVKNCRKIRLPAEKVPSQVEIDEFFAEAEKKEQKRFA 178 Query: 1340 DKFNFDIRKDLPLKGRYEWVRL 1275 DK+N+DI KDLPL+GRY+WVRL Sbjct: 179 DKYNYDIVKDLPLEGRYQWVRL 200 >ref|XP_002523560.1| conserved hypothetical protein [Ricinus communis] gi|223537122|gb|EEF38755.1| conserved hypothetical protein [Ricinus communis] Length = 219 Score = 91.3 bits (225), Expect = 7e-16 Identities = 46/86 (53%), Positives = 63/86 (73%), Gaps = 5/86 (5%) Frame = -1 Query: 1517 RREKTPSSSLRQE-SDEQESMERPTSVS----RHRSMSEMKTPSEAEIDEFFSTAEKDEQ 1353 RRE TPSS + +E SDE +S RP+++ R S++ K P+E E+DEFF+ AE++ Q Sbjct: 132 RRESTPSSEVGEELSDELDSTARPSAMEANSRRKPSLTVEKMPTETELDEFFAEAERNIQ 191 Query: 1352 RRFTDKFNFDIRKDLPLKGRYEWVRL 1275 +RF DK+N+D+ KD PLKGRYEWVRL Sbjct: 192 KRFADKYNYDVVKDEPLKGRYEWVRL 217 >ref|NP_001238139.1| cyclin-dependent kinase inhibitor 1;2 [Glycine max] gi|46844158|gb|AAS13375.1| cyclin-dependent kinase inhibitor 1;2 [Glycine max] Length = 198 Score = 88.6 bits (218), Expect = 5e-15 Identities = 45/82 (54%), Positives = 59/82 (71%), Gaps = 1/82 (1%) Frame = -1 Query: 1517 RREKTPSSSLRQESDEQESMERPTSVSRHRSMSEMKT-PSEAEIDEFFSTAEKDEQRRFT 1341 RRE SS LR+ S E E ME ++ HR++S+ K P+E E +EFF AEKD Q+RF Sbjct: 119 RREMKSSSELRENSQEPEPME----INSHRALSKAKAMPTELEXEEFFVAAEKDIQKRFQ 174 Query: 1340 DKFNFDIRKDLPLKGRYEWVRL 1275 DK+N+DI KD+PL+GRYEWV+L Sbjct: 175 DKYNYDIVKDVPLEGRYEWVQL 196