BLASTX nr result
ID: Coptis24_contig00002709
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00002709 (396 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003634663.1| PREDICTED: uncharacterized protein LOC100854... 64 1e-08 >ref|XP_003634663.1| PREDICTED: uncharacterized protein LOC100854863 [Vitis vinifera] gi|302142887|emb|CBI20182.3| unnamed protein product [Vitis vinifera] Length = 58 Score = 64.3 bits (155), Expect = 1e-08 Identities = 32/56 (57%), Positives = 41/56 (73%), Gaps = 2/56 (3%) Frame = +3 Query: 30 MPGEE--TAGPVLLRLLAFVGAGVICTSAINLWRDLERKAAQREKSEIPEDKLGSL 191 M GEE AGP +LR+L FVGAG ICT+AIN WRDL+RK+AQ+ ++PE +L Sbjct: 1 MIGEEGGPAGPKVLRMLYFVGAGFICTAAINKWRDLQRKSAQQHADQLPEKPANNL 56