BLASTX nr result
ID: Coptis24_contig00002200
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00002200 (598 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002524511.1| ATP binding protein, putative [Ricinus commu... 55 7e-06 >ref|XP_002524511.1| ATP binding protein, putative [Ricinus communis] gi|223536185|gb|EEF37838.1| ATP binding protein, putative [Ricinus communis] Length = 985 Score = 55.5 bits (132), Expect = 7e-06 Identities = 22/36 (61%), Positives = 28/36 (77%) Frame = -1 Query: 424 SDDKQTQSMSMDAPWTGSSTSVHDLYPVNPDSQYWK 317 + + QTQSMS+D PWTGSS+S DLYP+ DS YW+ Sbjct: 947 TSESQTQSMSLDGPWTGSSSSAGDLYPITLDSNYWE 982