BLASTX nr result
ID: Coptis24_contig00001841
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00001841 (535 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFK41721.1| unknown [Lotus japonicus] 71 1e-10 gb|ACU24145.1| unknown [Glycine max] 70 3e-10 ref|NP_001237734.1| cysteine proteinase inhibitor precursor [Gly... 70 3e-10 gb|AAM88397.1|AF525880_1 cysteine proteinase inhibitor [Colocasi... 69 4e-10 ref|XP_004165517.1| PREDICTED: cysteine proteinase inhibitor 12-... 67 1e-09 >gb|AFK41721.1| unknown [Lotus japonicus] Length = 237 Score = 70.9 bits (172), Expect = 1e-10 Identities = 31/40 (77%), Positives = 37/40 (92%) Frame = +1 Query: 1 AKFDMLLKMKRGSKEEKYKVEVHKNKAGTFHLNQVEQDHS 120 AKF++LLK+KRG KEEK+KVEVHKN G+FHLNQ+EQDHS Sbjct: 198 AKFNILLKLKRGEKEEKFKVEVHKNNEGSFHLNQMEQDHS 237 >gb|ACU24145.1| unknown [Glycine max] Length = 245 Score = 69.7 bits (169), Expect = 3e-10 Identities = 31/40 (77%), Positives = 36/40 (90%) Frame = +1 Query: 1 AKFDMLLKMKRGSKEEKYKVEVHKNKAGTFHLNQVEQDHS 120 AKF++LLK+KRG KEEK+KVEVHKN G FHLNQ+EQDHS Sbjct: 206 AKFNLLLKVKRGQKEEKFKVEVHKNNQGGFHLNQMEQDHS 245 >ref|NP_001237734.1| cysteine proteinase inhibitor precursor [Glycine max] gi|1944319|dbj|BAA19608.1| cysteine proteinase inhibitor [Glycine max] gi|1944342|dbj|BAA19610.1| cysteine proteinase inhibitor [Glycine max] Length = 245 Score = 69.7 bits (169), Expect = 3e-10 Identities = 31/40 (77%), Positives = 36/40 (90%) Frame = +1 Query: 1 AKFDMLLKMKRGSKEEKYKVEVHKNKAGTFHLNQVEQDHS 120 AKF++LLK+KRG KEEK+KVEVHKN G FHLNQ+EQDHS Sbjct: 206 AKFNLLLKVKRGQKEEKFKVEVHKNNQGGFHLNQMEQDHS 245 >gb|AAM88397.1|AF525880_1 cysteine proteinase inhibitor [Colocasia esculenta] Length = 205 Score = 68.9 bits (167), Expect = 4e-10 Identities = 31/40 (77%), Positives = 36/40 (90%) Frame = +1 Query: 1 AKFDMLLKMKRGSKEEKYKVEVHKNKAGTFHLNQVEQDHS 120 AK +LLK+KRGS+EEK+KVEVHKN GTFHLNQ+EQDHS Sbjct: 162 AKIHLLLKLKRGSREEKFKVEVHKNIEGTFHLNQMEQDHS 201 >ref|XP_004165517.1| PREDICTED: cysteine proteinase inhibitor 12-like [Cucumis sativus] Length = 202 Score = 67.4 bits (163), Expect = 1e-09 Identities = 31/40 (77%), Positives = 35/40 (87%) Frame = +1 Query: 1 AKFDMLLKMKRGSKEEKYKVEVHKNKAGTFHLNQVEQDHS 120 AKFD+LLK+KRGSKEEK+KVEVHKN G F LNQ+ QDHS Sbjct: 163 AKFDLLLKLKRGSKEEKFKVEVHKNNEGNFLLNQMVQDHS 202