BLASTX nr result
ID: Coptis24_contig00001588
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00001588 (449 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAN78125.1| dehydrin [Citrus x paradisi] 56 3e-06 >gb|AAN78125.1| dehydrin [Citrus x paradisi] Length = 234 Score = 56.2 bits (134), Expect = 3e-06 Identities = 24/49 (48%), Positives = 33/49 (67%) Frame = +2 Query: 5 DKKADEPAVVYHPTETKFPEDEAKEHKGIMEKIKEKLPGHNQNGEEKKE 151 D + P HPT + PE EAKE KGI+EK+KEKLPG++ E++K+ Sbjct: 178 DHQVPSPPAAEHPTSVEAPEAEAKEKKGILEKLKEKLPGYHPKSEDEKD 226