BLASTX nr result
ID: Coptis23_contig00042932
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00042932 (278 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003523888.1| PREDICTED: cytochrome P450 82C4-like [Glycin... 62 4e-08 ref|XP_002327096.1| cytochrome P450 [Populus trichocarpa] gi|222... 58 9e-07 ref|XP_002284031.1| PREDICTED: cytochrome P450 82C4 [Vitis vinif... 57 1e-06 ref|XP_002510297.1| cytochrome P450, putative [Ricinus communis]... 55 4e-06 ref|XP_003527707.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P... 55 6e-06 >ref|XP_003523888.1| PREDICTED: cytochrome P450 82C4-like [Glycine max] Length = 526 Score = 62.4 bits (150), Expect = 4e-08 Identities = 30/42 (71%), Positives = 33/42 (78%) Frame = +2 Query: 2 FKLDTPLGETVDMTESPGLTIPKATDLNVLVTPRLPFKLY*C 127 F+ TP + VDMTESPGLTIPKAT L VL+TPRLP KLY C Sbjct: 485 FEFATPSDQPVDMTESPGLTIPKATPLEVLLTPRLPAKLYAC 526 >ref|XP_002327096.1| cytochrome P450 [Populus trichocarpa] gi|222835411|gb|EEE73846.1| cytochrome P450 [Populus trichocarpa] Length = 392 Score = 57.8 bits (138), Expect = 9e-07 Identities = 27/40 (67%), Positives = 33/40 (82%) Frame = +2 Query: 2 FKLDTPLGETVDMTESPGLTIPKATDLNVLVTPRLPFKLY 121 F+L TP+ + VD+TES GLTIPKAT L V++TPRLP KLY Sbjct: 351 FELATPMDQPVDLTESSGLTIPKATPLEVILTPRLPPKLY 390 >ref|XP_002284031.1| PREDICTED: cytochrome P450 82C4 [Vitis vinifera] gi|302142392|emb|CBI19595.3| unnamed protein product [Vitis vinifera] Length = 527 Score = 57.4 bits (137), Expect = 1e-06 Identities = 28/40 (70%), Positives = 32/40 (80%) Frame = +2 Query: 2 FKLDTPLGETVDMTESPGLTIPKATDLNVLVTPRLPFKLY 121 F+L TP+ + VDMTES GLTIPKAT L VL+TPRL KLY Sbjct: 486 FELSTPVDQPVDMTESSGLTIPKATPLEVLLTPRLNSKLY 525 >ref|XP_002510297.1| cytochrome P450, putative [Ricinus communis] gi|223550998|gb|EEF52484.1| cytochrome P450, putative [Ricinus communis] Length = 526 Score = 55.5 bits (132), Expect = 4e-06 Identities = 25/42 (59%), Positives = 31/42 (73%) Frame = +2 Query: 2 FKLDTPLGETVDMTESPGLTIPKATDLNVLVTPRLPFKLY*C 127 F L TP+ + +DM+E PG +PKAT L VLV+PRLP KLY C Sbjct: 482 FDLATPMDQPIDMSEMPGTHVPKATPLEVLVSPRLPAKLYRC 523 >ref|XP_003527707.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 82C4-like [Glycine max] Length = 444 Score = 55.1 bits (131), Expect = 6e-06 Identities = 27/40 (67%), Positives = 31/40 (77%) Frame = +2 Query: 2 FKLDTPLGETVDMTESPGLTIPKATDLNVLVTPRLPFKLY 121 F+ TP + VDMTESPGLT+PKAT L VL+T RLP KLY Sbjct: 403 FEFATPSDQPVDMTESPGLTMPKATLLEVLLTSRLPAKLY 442