BLASTX nr result
ID: Coptis23_contig00042536
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00042536 (272 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002269573.2| PREDICTED: pentatricopeptide repeat-containi... 62 6e-08 emb|CBI38763.3| unnamed protein product [Vitis vinifera] 62 6e-08 emb|CAN61868.1| hypothetical protein VITISV_002466 [Vitis vinifera] 62 6e-08 ref|XP_003564788.1| PREDICTED: pentatricopeptide repeat-containi... 60 2e-07 ref|XP_003520055.1| PREDICTED: pentatricopeptide repeat-containi... 60 2e-07 >ref|XP_002269573.2| PREDICTED: pentatricopeptide repeat-containing protein At4g33170-like [Vitis vinifera] Length = 786 Score = 61.6 bits (148), Expect = 6e-08 Identities = 23/31 (74%), Positives = 26/31 (83%) Frame = +2 Query: 5 VSSVYQRRIVLRDSNCFHHFREGICSCRDYW 97 VS V+ R ++LRDSNCFHHFREG CSC DYW Sbjct: 756 VSGVFHRHVILRDSNCFHHFREGACSCSDYW 786 >emb|CBI38763.3| unnamed protein product [Vitis vinifera] Length = 719 Score = 61.6 bits (148), Expect = 6e-08 Identities = 23/31 (74%), Positives = 26/31 (83%) Frame = +2 Query: 5 VSSVYQRRIVLRDSNCFHHFREGICSCRDYW 97 VS V+ R ++LRDSNCFHHFREG CSC DYW Sbjct: 689 VSGVFHRHVILRDSNCFHHFREGACSCSDYW 719 >emb|CAN61868.1| hypothetical protein VITISV_002466 [Vitis vinifera] Length = 440 Score = 61.6 bits (148), Expect = 6e-08 Identities = 23/31 (74%), Positives = 26/31 (83%) Frame = +2 Query: 5 VSSVYQRRIVLRDSNCFHHFREGICSCRDYW 97 VS V+ R ++LRDSNCFHHFREG CSC DYW Sbjct: 410 VSGVFHRHVILRDSNCFHHFREGACSCSDYW 440 >ref|XP_003564788.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33170-like [Brachypodium distachyon] Length = 515 Score = 60.1 bits (144), Expect = 2e-07 Identities = 22/32 (68%), Positives = 27/32 (84%) Frame = +2 Query: 2 LVSSVYQRRIVLRDSNCFHHFREGICSCRDYW 97 +V+ VY R I+LRDSNCFHH R+G+CSC DYW Sbjct: 484 MVAKVYGREIILRDSNCFHHMRDGVCSCGDYW 515 >ref|XP_003520055.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650-like [Glycine max] Length = 852 Score = 59.7 bits (143), Expect = 2e-07 Identities = 22/31 (70%), Positives = 26/31 (83%) Frame = +2 Query: 5 VSSVYQRRIVLRDSNCFHHFREGICSCRDYW 97 +S V+ R I+LRDSNCFHHF+EG CSC DYW Sbjct: 822 ISGVFTRHIILRDSNCFHHFKEGECSCEDYW 852