BLASTX nr result
ID: Coptis23_contig00042464
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00042464 (260 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI31931.3| unnamed protein product [Vitis vinifera] 102 3e-20 ref|XP_002268605.1| PREDICTED: mitochondrial uncoupling protein ... 102 3e-20 ref|XP_002892790.1| mitochondrial substrate carrier family prote... 102 4e-20 emb|CAN75338.1| hypothetical protein VITISV_014417 [Vitis vinifera] 102 4e-20 gb|AFK47248.1| unknown [Lotus japonicus] 101 7e-20 >emb|CBI31931.3| unnamed protein product [Vitis vinifera] Length = 280 Score = 102 bits (254), Expect = 3e-20 Identities = 43/51 (84%), Positives = 46/51 (90%) Frame = +3 Query: 3 NSYDCLVKTIRYEGLRALWKGFFPTWARLGPWQFVFWVSYEKLRRIVGFST 155 NSYDCLVKT+R EGLRALWKGFFPTWARLGPWQFVFWVSYEK R + G S+ Sbjct: 229 NSYDCLVKTVRVEGLRALWKGFFPTWARLGPWQFVFWVSYEKFRELAGLSS 279 >ref|XP_002268605.1| PREDICTED: mitochondrial uncoupling protein 4 [Vitis vinifera] Length = 299 Score = 102 bits (254), Expect = 3e-20 Identities = 43/51 (84%), Positives = 46/51 (90%) Frame = +3 Query: 3 NSYDCLVKTIRYEGLRALWKGFFPTWARLGPWQFVFWVSYEKLRRIVGFST 155 NSYDCLVKT+R EGLRALWKGFFPTWARLGPWQFVFWVSYEK R + G S+ Sbjct: 248 NSYDCLVKTVRVEGLRALWKGFFPTWARLGPWQFVFWVSYEKFRELAGLSS 298 >ref|XP_002892790.1| mitochondrial substrate carrier family protein [Arabidopsis lyrata subsp. lyrata] gi|297338632|gb|EFH69049.1| mitochondrial substrate carrier family protein [Arabidopsis lyrata subsp. lyrata] Length = 305 Score = 102 bits (253), Expect = 4e-20 Identities = 42/51 (82%), Positives = 47/51 (92%) Frame = +3 Query: 3 NSYDCLVKTIRYEGLRALWKGFFPTWARLGPWQFVFWVSYEKLRRIVGFST 155 NSYDCLVKT+R EG+RALWKGFFPTWARLGPWQFVFWVSYEK R++ G S+ Sbjct: 254 NSYDCLVKTVRLEGIRALWKGFFPTWARLGPWQFVFWVSYEKFRQLAGISS 304 >emb|CAN75338.1| hypothetical protein VITISV_014417 [Vitis vinifera] Length = 280 Score = 102 bits (253), Expect = 4e-20 Identities = 43/51 (84%), Positives = 46/51 (90%) Frame = +3 Query: 3 NSYDCLVKTIRYEGLRALWKGFFPTWARLGPWQFVFWVSYEKLRRIVGFST 155 NSYDCLVKT+R EGLRALWKGFFPTWARLGPWQFVFWVSYEK R + G S+ Sbjct: 229 NSYDCLVKTVRVEGLRALWKGFFPTWARLGPWQFVFWVSYEKFRELXGLSS 279 >gb|AFK47248.1| unknown [Lotus japonicus] Length = 306 Score = 101 bits (251), Expect = 7e-20 Identities = 41/51 (80%), Positives = 48/51 (94%) Frame = +3 Query: 3 NSYDCLVKTIRYEGLRALWKGFFPTWARLGPWQFVFWVSYEKLRRIVGFST 155 +SYDCLVKT++ EG+RALWKGFFPTWARLGPWQFVFWVSYEKLR++ G S+ Sbjct: 255 SSYDCLVKTVKLEGIRALWKGFFPTWARLGPWQFVFWVSYEKLRKVAGLSS 305