BLASTX nr result
ID: Coptis23_contig00042211
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00042211 (275 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI39785.3| unnamed protein product [Vitis vinifera] 105 3e-21 emb|CAN74282.1| hypothetical protein VITISV_016708 [Vitis vinifera] 105 3e-21 ref|XP_002267586.2| PREDICTED: E3 ubiquitin-protein ligase At4g1... 96 2e-18 ref|XP_002864420.1| zinc finger family protein [Arabidopsis lyra... 93 3e-17 gb|ACU18237.1| unknown [Glycine max] 92 4e-17 >emb|CBI39785.3| unnamed protein product [Vitis vinifera] Length = 343 Score = 105 bits (263), Expect = 3e-21 Identities = 58/95 (61%), Positives = 71/95 (74%), Gaps = 4/95 (4%) Frame = -2 Query: 274 RYYYSPDMMMYSTGIPVT-SSTDP-GENRFGRNLF--STPIHPSSFLLRAAMRISRARWF 107 RY++ PD + S GI V+ SS P GE+R + S+ PSSFL+R AMRISRARWF Sbjct: 4 RYFFPPDSLCNS-GISVSFSSLSPAGEDRMAAGVRNRSSRAPPSSFLIRTAMRISRARWF 62 Query: 106 SFLRRVFHYQNGSRSDLGSNPFSSGSWIALEFLVL 2 SFLRRVFHYQNGSRSDLG+NPF+S +W+ LEF+ L Sbjct: 63 SFLRRVFHYQNGSRSDLGANPFNSSTWMILEFIAL 97 >emb|CAN74282.1| hypothetical protein VITISV_016708 [Vitis vinifera] Length = 343 Score = 105 bits (263), Expect = 3e-21 Identities = 58/95 (61%), Positives = 71/95 (74%), Gaps = 4/95 (4%) Frame = -2 Query: 274 RYYYSPDMMMYSTGIPVT-SSTDP-GENRFGRNLF--STPIHPSSFLLRAAMRISRARWF 107 RY++ PD + S GI V+ SS P GE+R + S+ PSSFL+R AMRISRARWF Sbjct: 4 RYFFPPDSLCNS-GISVSFSSLSPAGEDRMAAGVRNRSSRAPPSSFLIRTAMRISRARWF 62 Query: 106 SFLRRVFHYQNGSRSDLGSNPFSSGSWIALEFLVL 2 SFLRRVFHYQNGSRSDLG+NPF+S +W+ LEF+ L Sbjct: 63 SFLRRVFHYQNGSRSDLGANPFNSNTWMILEFIAL 97 >ref|XP_002267586.2| PREDICTED: E3 ubiquitin-protein ligase At4g11680 [Vitis vinifera] Length = 312 Score = 96.3 bits (238), Expect = 2e-18 Identities = 43/53 (81%), Positives = 49/53 (92%) Frame = -2 Query: 160 PSSFLLRAAMRISRARWFSFLRRVFHYQNGSRSDLGSNPFSSGSWIALEFLVL 2 PSSFL+R AMRISRARWFSFLRRVFHYQNGSRSDLG+NPF+S +W+ LEF+ L Sbjct: 14 PSSFLIRTAMRISRARWFSFLRRVFHYQNGSRSDLGANPFNSSTWMILEFIAL 66 >ref|XP_002864420.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] gi|297310255|gb|EFH40679.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] Length = 343 Score = 92.8 bits (229), Expect = 3e-17 Identities = 47/96 (48%), Positives = 61/96 (63%), Gaps = 5/96 (5%) Frame = -2 Query: 274 RYYYSPDMMMYSTGIPVTSSTD-----PGENRFGRNLFSTPIHPSSFLLRAAMRISRARW 110 RY P++ + I ++SS GEN + + PSSF +R AM++SRARW Sbjct: 4 RYSVQPELSSNNISITISSSASLSSSPRGENSHAADGNAQERSPSSFYIRLAMKVSRARW 63 Query: 109 FSFLRRVFHYQNGSRSDLGSNPFSSGSWIALEFLVL 2 F FLRRVFHYQNGSRSDLGSNPF+S +W+ E + L Sbjct: 64 FIFLRRVFHYQNGSRSDLGSNPFNSSTWMMSELIAL 99 >gb|ACU18237.1| unknown [Glycine max] Length = 365 Score = 92.0 bits (227), Expect = 4e-17 Identities = 41/55 (74%), Positives = 49/55 (89%) Frame = -2 Query: 166 IHPSSFLLRAAMRISRARWFSFLRRVFHYQNGSRSDLGSNPFSSGSWIALEFLVL 2 + P SFL+R AMRISRARWF+FLRRVFHYQNGSRS+LGSNPF+S +W+ LEF+ L Sbjct: 39 VTPPSFLVRIAMRISRARWFTFLRRVFHYQNGSRSNLGSNPFNSSTWMMLEFIAL 93