BLASTX nr result
ID: Coptis23_contig00042154
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00042154 (291 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002278172.1| PREDICTED: pentatricopeptide repeat-containi... 158 5e-37 emb|CAN70963.1| hypothetical protein VITISV_038268 [Vitis vinifera] 158 5e-37 ref|XP_002523294.1| pentatricopeptide repeat-containing protein,... 157 9e-37 ref|XP_004145716.1| PREDICTED: pentatricopeptide repeat-containi... 142 3e-32 ref|NP_197146.1| pentatricopeptide repeat-containing protein [Ar... 137 7e-31 >ref|XP_002278172.1| PREDICTED: pentatricopeptide repeat-containing protein At5g16420, mitochondrial [Vitis vinifera] gi|296089757|emb|CBI39576.3| unnamed protein product [Vitis vinifera] Length = 586 Score = 158 bits (399), Expect = 5e-37 Identities = 73/96 (76%), Positives = 82/96 (85%) Frame = +1 Query: 1 KSQLKCSENLFVMVIRNYGIASRINFAVRTFLRIKEFGIERSVRSFNTLLNALVQNKRYD 180 KSQ+KC ENLF+ VIRNYG A R A+RTFLRI FG++ SVRSFNTLLN LVQNKR+D Sbjct: 163 KSQIKCGENLFITVIRNYGFAGRPKLAIRTFLRIPSFGLQPSVRSFNTLLNTLVQNKRFD 222 Query: 181 LVHFLFKNCNNKFGIVPNVFTCNILVKALCKKNDVE 288 LVH +FKNC KFGIVPNVFTCNILVKALCKKND++ Sbjct: 223 LVHLMFKNCRKKFGIVPNVFTCNILVKALCKKNDID 258 >emb|CAN70963.1| hypothetical protein VITISV_038268 [Vitis vinifera] Length = 844 Score = 158 bits (399), Expect = 5e-37 Identities = 73/96 (76%), Positives = 82/96 (85%) Frame = +1 Query: 1 KSQLKCSENLFVMVIRNYGIASRINFAVRTFLRIKEFGIERSVRSFNTLLNALVQNKRYD 180 KSQ+KC ENLF+ VIRNYG A R A+RTFLRI FG++ SVRSFNTLLN LVQNKR+D Sbjct: 163 KSQIKCGENLFITVIRNYGFAGRPKLAIRTFLRIPSFGLQPSVRSFNTLLNTLVQNKRFD 222 Query: 181 LVHFLFKNCNNKFGIVPNVFTCNILVKALCKKNDVE 288 LVH +FKNC KFGIVPNVFTCNILVKALCKKND++ Sbjct: 223 LVHLMFKNCRKKFGIVPNVFTCNILVKALCKKNDID 258 >ref|XP_002523294.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223537382|gb|EEF39010.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 544 Score = 157 bits (397), Expect = 9e-37 Identities = 69/96 (71%), Positives = 87/96 (90%) Frame = +1 Query: 1 KSQLKCSENLFVMVIRNYGIASRINFAVRTFLRIKEFGIERSVRSFNTLLNALVQNKRYD 180 KSQ+KC EN+F+ VIRNYG+A + +FA+RTF+RI++F ++RSVRS NTLLNA VQNKRYD Sbjct: 123 KSQIKCGENIFINVIRNYGLAGKPDFALRTFIRIQDFNVQRSVRSLNTLLNAFVQNKRYD 182 Query: 181 LVHFLFKNCNNKFGIVPNVFTCNILVKALCKKNDVE 288 LVH +FKNC +K+G++PNVFTCNIL+KALCKKNDVE Sbjct: 183 LVHAMFKNCRSKYGVLPNVFTCNILIKALCKKNDVE 218 >ref|XP_004145716.1| PREDICTED: pentatricopeptide repeat-containing protein At5g16420, mitochondrial-like [Cucumis sativus] gi|449492939|ref|XP_004159147.1| PREDICTED: pentatricopeptide repeat-containing protein At5g16420, mitochondrial-like [Cucumis sativus] Length = 535 Score = 142 bits (358), Expect = 3e-32 Identities = 67/96 (69%), Positives = 80/96 (83%) Frame = +1 Query: 4 SQLKCSENLFVMVIRNYGIASRINFAVRTFLRIKEFGIERSVRSFNTLLNALVQNKRYDL 183 S + CSE+LF+ VIR+YG+ASR A++TFLRI+ FG+ RSVRS NTLLNALVQN R+ Sbjct: 115 SGINCSEDLFITVIRSYGLASRPKMALKTFLRIQTFGVRRSVRSLNTLLNALVQNNRFSS 174 Query: 184 VHFLFKNCNNKFGIVPNVFTCNILVKALCKKNDVEG 291 VH LFK +KFG+VPNVFTCNIL+KALCKKNDVEG Sbjct: 175 VHLLFKYSKSKFGVVPNVFTCNILIKALCKKNDVEG 210 >ref|NP_197146.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75170213|sp|Q9FFE3.1|PP388_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At5g16420, mitochondrial; Flags: Precursor gi|9759124|dbj|BAB09609.1| salt-inducible protein-like [Arabidopsis thaliana] gi|332004907|gb|AED92290.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 535 Score = 137 bits (346), Expect = 7e-31 Identities = 60/93 (64%), Positives = 77/93 (82%) Frame = +1 Query: 10 LKCSENLFVMVIRNYGIASRINFAVRTFLRIKEFGIERSVRSFNTLLNALVQNKRYDLVH 189 +KC ENLF+ ++RNYG+A R ++R FLRI +FG++RSVRS NTLLN L+QN+R+DLVH Sbjct: 116 IKCGENLFIDLLRNYGLAGRYESSMRIFLRIPDFGVKRSVRSLNTLLNVLIQNQRFDLVH 175 Query: 190 FLFKNCNNKFGIVPNVFTCNILVKALCKKNDVE 288 +FKN FGI PN+FTCN+LVKALCKKND+E Sbjct: 176 AMFKNSKESFGITPNIFTCNLLVKALCKKNDIE 208