BLASTX nr result
ID: Coptis23_contig00042117
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00042117 (259 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003632276.1| PREDICTED: putative SWI/SNF-related matrix-a... 129 3e-28 emb|CBI17093.3| unnamed protein product [Vitis vinifera] 129 3e-28 ref|XP_002270098.1| PREDICTED: putative SWI/SNF-related matrix-a... 129 3e-28 ref|XP_002527439.1| DNA repair helicase rad5,16, putative [Ricin... 123 1e-26 ref|XP_003540216.1| PREDICTED: putative SWI/SNF-related matrix-a... 123 2e-26 >ref|XP_003632276.1| PREDICTED: putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 2-like [Vitis vinifera] Length = 1029 Score = 129 bits (324), Expect = 3e-28 Identities = 60/86 (69%), Positives = 77/86 (89%) Frame = +2 Query: 2 DKKIRVEGQCKYAPDVLGIMDTVVLLVSVYINSSMFRKFHKTSIKSANSVNEESVVHPLP 181 DKK+++EG CK APDVLGIMDT++L +SVYINSSMFRK +TS+++A++ +EESVVH LP Sbjct: 197 DKKVKIEGFCKAAPDVLGIMDTILLSISVYINSSMFRKCQQTSLRAASNSSEESVVHALP 256 Query: 182 TLFKLLGMTAFKKAEVTPEDLYTRKR 259 TLF+LLG+T FKKAE +P+DLYTRKR Sbjct: 257 TLFRLLGLTPFKKAEFSPDDLYTRKR 282 >emb|CBI17093.3| unnamed protein product [Vitis vinifera] Length = 1025 Score = 129 bits (324), Expect = 3e-28 Identities = 60/86 (69%), Positives = 77/86 (89%) Frame = +2 Query: 2 DKKIRVEGQCKYAPDVLGIMDTVVLLVSVYINSSMFRKFHKTSIKSANSVNEESVVHPLP 181 DKK+++EG CK APDVLGIMDT++L +SVYINSSMFRK +TS+++A++ +EESVVH LP Sbjct: 193 DKKVKIEGFCKAAPDVLGIMDTILLSISVYINSSMFRKCQQTSLRAASNSSEESVVHALP 252 Query: 182 TLFKLLGMTAFKKAEVTPEDLYTRKR 259 TLF+LLG+T FKKAE +P+DLYTRKR Sbjct: 253 TLFRLLGLTPFKKAEFSPDDLYTRKR 278 >ref|XP_002270098.1| PREDICTED: putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 2-like isoform 2 [Vitis vinifera] Length = 1016 Score = 129 bits (324), Expect = 3e-28 Identities = 60/86 (69%), Positives = 77/86 (89%) Frame = +2 Query: 2 DKKIRVEGQCKYAPDVLGIMDTVVLLVSVYINSSMFRKFHKTSIKSANSVNEESVVHPLP 181 DKK+++EG CK APDVLGIMDT++L +SVYINSSMFRK +TS+++A++ +EESVVH LP Sbjct: 184 DKKVKIEGFCKAAPDVLGIMDTILLSISVYINSSMFRKCQQTSLRAASNSSEESVVHALP 243 Query: 182 TLFKLLGMTAFKKAEVTPEDLYTRKR 259 TLF+LLG+T FKKAE +P+DLYTRKR Sbjct: 244 TLFRLLGLTPFKKAEFSPDDLYTRKR 269 >ref|XP_002527439.1| DNA repair helicase rad5,16, putative [Ricinus communis] gi|223533174|gb|EEF34931.1| DNA repair helicase rad5,16, putative [Ricinus communis] Length = 1028 Score = 123 bits (309), Expect = 1e-26 Identities = 55/85 (64%), Positives = 72/85 (84%) Frame = +2 Query: 5 KKIRVEGQCKYAPDVLGIMDTVVLLVSVYINSSMFRKFHKTSIKSANSVNEESVVHPLPT 184 KK+R+EG CK APD+LGIMDT++L +SVYINS++FR +TS+K+ ++ EE++VHPLP Sbjct: 196 KKVRIEGYCKSAPDILGIMDTILLSISVYINSALFRMHQQTSLKAVSNPTEETIVHPLPN 255 Query: 185 LFKLLGMTAFKKAEVTPEDLYTRKR 259 LF+LLG+T FKKAE TP DLYTRKR Sbjct: 256 LFRLLGLTPFKKAEFTPADLYTRKR 280 >ref|XP_003540216.1| PREDICTED: putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 2-like [Glycine max] Length = 1008 Score = 123 bits (308), Expect = 2e-26 Identities = 57/86 (66%), Positives = 71/86 (82%) Frame = +2 Query: 2 DKKIRVEGQCKYAPDVLGIMDTVVLLVSVYINSSMFRKFHKTSIKSANSVNEESVVHPLP 181 D K+R+EGQCKYAP+VLGIMD++VL VSV+INSSMF K H+ S+K A + +ESV HPLP Sbjct: 177 DHKVRIEGQCKYAPNVLGIMDSIVLSVSVFINSSMFDKHHQVSLKDAANSTDESVFHPLP 236 Query: 182 TLFKLLGMTAFKKAEVTPEDLYTRKR 259 TLF+LLG+ FKKAE+TP D Y+ KR Sbjct: 237 TLFRLLGLNPFKKAELTPGDFYSNKR 262