BLASTX nr result
ID: Coptis23_contig00041995
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00041995 (253 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002460305.1| hypothetical protein SORBIDRAFT_02g026226 [S... 57 1e-06 ref|XP_002316906.1| predicted protein [Populus trichocarpa] gi|2... 55 8e-06 >ref|XP_002460305.1| hypothetical protein SORBIDRAFT_02g026226 [Sorghum bicolor] gi|241923682|gb|EER96826.1| hypothetical protein SORBIDRAFT_02g026226 [Sorghum bicolor] Length = 294 Score = 57.4 bits (137), Expect = 1e-06 Identities = 21/41 (51%), Positives = 34/41 (82%) Frame = -1 Query: 160 VSSLTEDLLMEVLSRLPIKSIVQCKSICKSWCTLISSNHFI 38 V+ + +D++ +LS+LP KS+++CKS+CK+W T+ISS HFI Sbjct: 4 VACIPDDVIFNILSQLPTKSVIRCKSVCKAWLTIISSEHFI 44 >ref|XP_002316906.1| predicted protein [Populus trichocarpa] gi|222859971|gb|EEE97518.1| predicted protein [Populus trichocarpa] Length = 381 Score = 54.7 bits (130), Expect = 8e-06 Identities = 24/44 (54%), Positives = 33/44 (75%) Frame = -1 Query: 151 LTEDLLMEVLSRLPIKSIVQCKSICKSWCTLISSNHFIIFQLNH 20 L+EDL+ E+L +LPIKS+++C S+CKSW +LI S FI L H Sbjct: 5 LSEDLIQEILYKLPIKSLLRCTSLCKSWNSLIKSPTFIFKHLQH 48