BLASTX nr result
ID: Coptis23_contig00041975
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00041975 (324 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_817236.1| ORF58d [Pinus koraiensis] gi|29469754|gb|AAO740... 74 2e-11 ref|YP_006503856.1| ribosomal protein L2 (chloroplast) [Datura s... 68 7e-10 ref|XP_004173990.1| PREDICTED: 50S ribosomal protein L2, chlorop... 67 2e-09 ref|YP_173359.1| hypothetical protein NitaMp011 [Nicotiana tabac... 67 2e-09 gb|AEO13832.1| ribosomal protein L2 [Camellia sinensis] 67 2e-09 >ref|NP_817236.1| ORF58d [Pinus koraiensis] gi|29469754|gb|AAO74082.1| ORF58d [Pinus koraiensis] Length = 58 Score = 73.6 bits (179), Expect = 2e-11 Identities = 34/52 (65%), Positives = 42/52 (80%) Frame = +3 Query: 168 LGFAVNLIGYFQLRKSIVQTALKGRAFPIEIGTSVPETMVSPIIAPLGCKIY 323 +GFAVN IG F+ RK I+QTAL+GR FPI+IG PE +VSPI+ PLGC+IY Sbjct: 1 MGFAVNPIGCFRSRKLIIQTALRGRTFPIDIGAFGPERIVSPIMTPLGCRIY 52 >ref|YP_006503856.1| ribosomal protein L2 (chloroplast) [Datura stramonium] gi|350996490|gb|AEQ37002.1| ribosomal protein L2 (chloroplast) [Datura stramonium] gi|350996578|gb|AEQ37089.1| ribosomal protein L2 [Datura stramonium] Length = 268 Score = 68.2 bits (165), Expect = 7e-10 Identities = 33/38 (86%), Positives = 35/38 (92%) Frame = -3 Query: 322 YILHPRGAIIGDTIVSGTEVPISMGNALPLSAV*TIDL 209 YILHPRGAIIGDTIVSGTEVPI MGNALPLSAV I++ Sbjct: 101 YILHPRGAIIGDTIVSGTEVPIKMGNALPLSAVHNIEI 138 >ref|XP_004173990.1| PREDICTED: 50S ribosomal protein L2, chloroplastic-like [Cucumis sativus] Length = 133 Score = 66.6 bits (161), Expect = 2e-09 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = -3 Query: 322 YILHPRGAIIGDTIVSGTEVPISMGNALPLSAV 224 YILHPRGAIIGDTIVSGTEVPI MGNALPLSAV Sbjct: 101 YILHPRGAIIGDTIVSGTEVPIKMGNALPLSAV 133 >ref|YP_173359.1| hypothetical protein NitaMp011 [Nicotiana tabacum] gi|56806521|dbj|BAD83422.1| hypothetical protein (mitochondrion) [Nicotiana tabacum] Length = 133 Score = 66.6 bits (161), Expect = 2e-09 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = -3 Query: 322 YILHPRGAIIGDTIVSGTEVPISMGNALPLSAV 224 YILHPRGAIIGDTIVSGTEVPI MGNALPLSAV Sbjct: 101 YILHPRGAIIGDTIVSGTEVPIKMGNALPLSAV 133 >gb|AEO13832.1| ribosomal protein L2 [Camellia sinensis] Length = 133 Score = 66.6 bits (161), Expect = 2e-09 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = -3 Query: 322 YILHPRGAIIGDTIVSGTEVPISMGNALPLSAV 224 YILHPRGAIIGDTIVSGTEVPI MGNALPLSAV Sbjct: 101 YILHPRGAIIGDTIVSGTEVPIKMGNALPLSAV 133