BLASTX nr result
ID: Coptis23_contig00041931
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00041931 (285 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002314482.1| predicted protein [Populus trichocarpa] gi|2... 93 2e-17 ref|XP_002883427.1| nucleic acid binding protein [Arabidopsis ly... 81 8e-14 ref|NP_001118682.1| RNA recognition motif-containing protein [Ar... 78 8e-13 ref|NP_188979.2| RNA recognition motif-containing protein [Arabi... 78 8e-13 gb|ABF59161.1| unknown protein [Arabidopsis thaliana] 57 1e-06 >ref|XP_002314482.1| predicted protein [Populus trichocarpa] gi|222863522|gb|EEF00653.1| predicted protein [Populus trichocarpa] Length = 702 Score = 93.2 bits (230), Expect = 2e-17 Identities = 47/94 (50%), Positives = 68/94 (72%) Frame = +2 Query: 2 GVCGIPPSFVKNPTRTVMVKGLPHNVSSHHLEETFSFSGARITAFFMGSSSSVAYIEFET 181 G I + VK+PTRTV +K L ++SSH L+E SF + I F +G+SSS AY+EFE+ Sbjct: 490 GDIDISVALVKHPTRTVKIKQLTDDISSHQLKEALSFCRSGINVF-LGASSSNAYVEFES 548 Query: 182 DEAKEKAIASCSIPISGSKLSVFRIDAPVTTIVR 283 ++AKE+A+A + +SG +LS+FR+DAP TT+VR Sbjct: 549 EDAKERALAKHFLQVSGKQLSIFRVDAPRTTVVR 582 >ref|XP_002883427.1| nucleic acid binding protein [Arabidopsis lyrata subsp. lyrata] gi|297329267|gb|EFH59686.1| nucleic acid binding protein [Arabidopsis lyrata subsp. lyrata] Length = 785 Score = 81.3 bits (199), Expect = 8e-14 Identities = 38/90 (42%), Positives = 60/90 (66%) Frame = +2 Query: 14 IPPSFVKNPTRTVMVKGLPHNVSSHHLEETFSFSGARITAFFMGSSSSVAYIEFETDEAK 193 +P + VK P+RTV + L H+ SS+ ++E F + I+ F +GSS + A++EFET++ K Sbjct: 578 VPVALVKEPSRTVKIHPLTHDFSSNQIKEALKFCRSNISKFILGSSRTDAFVEFETEDGK 637 Query: 194 EKAIASCSIPISGSKLSVFRIDAPVTTIVR 283 E+A+A SI I ++L + RID P TT+ R Sbjct: 638 ERALAEHSISICNTQLFISRIDIPRTTVAR 667 >ref|NP_001118682.1| RNA recognition motif-containing protein [Arabidopsis thaliana] gi|332643237|gb|AEE76758.1| RNA recognition motif-containing protein [Arabidopsis thaliana] Length = 771 Score = 77.8 bits (190), Expect = 8e-13 Identities = 37/90 (41%), Positives = 58/90 (64%) Frame = +2 Query: 14 IPPSFVKNPTRTVMVKGLPHNVSSHHLEETFSFSGARITAFFMGSSSSVAYIEFETDEAK 193 +P + VK P RTV + L H+ SS+ ++E F + I+ F +GSS + A++EFET++ K Sbjct: 564 VPVALVKEPARTVKIHPLTHDFSSNQIKEALKFCRSNISKFTLGSSRTDAFVEFETEDGK 623 Query: 194 EKAIASCSIPISGSKLSVFRIDAPVTTIVR 283 E+A+A SI I ++L + RID P T + R Sbjct: 624 ERALAEHSISICNTQLFISRIDIPRTIVAR 653 >ref|NP_188979.2| RNA recognition motif-containing protein [Arabidopsis thaliana] gi|11994322|dbj|BAB02281.1| unnamed protein product [Arabidopsis thaliana] gi|332643236|gb|AEE76757.1| RNA recognition motif-containing protein [Arabidopsis thaliana] Length = 811 Score = 77.8 bits (190), Expect = 8e-13 Identities = 37/90 (41%), Positives = 58/90 (64%) Frame = +2 Query: 14 IPPSFVKNPTRTVMVKGLPHNVSSHHLEETFSFSGARITAFFMGSSSSVAYIEFETDEAK 193 +P + VK P RTV + L H+ SS+ ++E F + I+ F +GSS + A++EFET++ K Sbjct: 604 VPVALVKEPARTVKIHPLTHDFSSNQIKEALKFCRSNISKFTLGSSRTDAFVEFETEDGK 663 Query: 194 EKAIASCSIPISGSKLSVFRIDAPVTTIVR 283 E+A+A SI I ++L + RID P T + R Sbjct: 664 ERALAEHSISICNTQLFISRIDIPRTIVAR 693 >gb|ABF59161.1| unknown protein [Arabidopsis thaliana] Length = 226 Score = 57.4 bits (137), Expect = 1e-06 Identities = 27/67 (40%), Positives = 44/67 (65%) Frame = +2 Query: 83 SHHLEETFSFSGARITAFFMGSSSSVAYIEFETDEAKEKAIASCSIPISGSKLSVFRIDA 262 S+ ++E F + I+ F +GSS + A++EFET++ KE+A+A SI I ++L + RID Sbjct: 42 SNQIKEALKFCRSNISKFTLGSSRTDAFVEFETEDGKERALAEHSISICNTQLFISRIDI 101 Query: 263 PVTTIVR 283 P T + R Sbjct: 102 PRTIVAR 108