BLASTX nr result
ID: Coptis23_contig00041865
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00041865 (246 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABW81176.1| non-LTR reverse transcriptase [Arabidopsis cebenn... 55 6e-06 >gb|ABW81176.1| non-LTR reverse transcriptase [Arabidopsis cebennensis] Length = 464 Score = 55.1 bits (131), Expect = 6e-06 Identities = 23/41 (56%), Positives = 31/41 (75%) Frame = +3 Query: 117 QKSGQNWVKDYARNTRFFHISTLYRRRKNKIEKLKNDEGTW 239 QKS + W+ RNT++FH ST+ RRR+N+IE LK+DEG W Sbjct: 311 QKSREKWIALGDRNTKYFHTSTIIRRRRNQIEMLKDDEGKW 351