BLASTX nr result
ID: Coptis23_contig00041718
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00041718 (289 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002283651.1| PREDICTED: pentatricopeptide repeat-containi... 97 1e-18 ref|XP_003523513.1| PREDICTED: pentatricopeptide repeat-containi... 90 2e-16 ref|XP_003543566.1| PREDICTED: pentatricopeptide repeat-containi... 89 3e-16 gb|AAS79604.1| putative pentatricopeptide repeat-containing prot... 82 5e-14 ref|XP_003603974.1| Pentatricopeptide repeat-containing protein ... 77 1e-12 >ref|XP_002283651.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065 [Vitis vinifera] gi|297744424|emb|CBI37686.3| unnamed protein product [Vitis vinifera] Length = 571 Score = 97.1 bits (240), Expect = 1e-18 Identities = 47/77 (61%), Positives = 57/77 (74%), Gaps = 7/77 (9%) Frame = -1 Query: 214 NNMEKRFGIRPTIQHYGCMVDLLARVGHLKEAELFVKRMPIEP-------LIWACKMHGD 56 N+M ++GI+PTIQHYGCMVDLLAR GHL EAE F+++MPIEP LIWA K+HGD Sbjct: 322 NSMWCKYGIKPTIQHYGCMVDLLARTGHLDEAEEFIRKMPIEPDVVLWRTLIWASKVHGD 381 Query: 55 HDRGDGLMNQNQLLQMD 5 DR + LM LL+MD Sbjct: 382 IDRSEQLMKDRGLLKMD 398 >ref|XP_003523513.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Glycine max] Length = 542 Score = 89.7 bits (221), Expect = 2e-16 Identities = 41/76 (53%), Positives = 56/76 (73%), Gaps = 7/76 (9%) Frame = -1 Query: 214 NNMEKRFGIRPTIQHYGCMVDLLARVGHLKEAELFVKRMPIEP-------LIWACKMHGD 56 +++++R+G++P+IQH+GC+VDLLAR G LKEAE FV MPIEP LIWACK+HGD Sbjct: 293 SDVQRRYGMKPSIQHFGCLVDLLARAGRLKEAEDFVNAMPIEPDAVLWRTLIWACKVHGD 352 Query: 55 HDRGDGLMNQNQLLQM 8 DR + LM ++ M Sbjct: 353 DDRAERLMKHLEIQDM 368 >ref|XP_003543566.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Glycine max] Length = 572 Score = 89.4 bits (220), Expect = 3e-16 Identities = 41/76 (53%), Positives = 56/76 (73%), Gaps = 7/76 (9%) Frame = -1 Query: 214 NNMEKRFGIRPTIQHYGCMVDLLARVGHLKEAELFVKRMPIEP-------LIWACKMHGD 56 +++++R+G++P+IQH+GC+VDLLAR G LKEAE FV MPIEP LIWACK+HGD Sbjct: 323 SDVQRRYGMKPSIQHFGCLVDLLARAGRLKEAEDFVNAMPIEPDTVLWRTLIWACKVHGD 382 Query: 55 HDRGDGLMNQNQLLQM 8 DR + LM ++ M Sbjct: 383 ADRAERLMKHLEIQDM 398 >gb|AAS79604.1| putative pentatricopeptide repeat-containing protein [Ipomoea trifida] gi|118562903|dbj|BAF37793.1| hypothetical protein [Ipomoea trifida] Length = 575 Score = 82.0 bits (201), Expect = 5e-14 Identities = 38/73 (52%), Positives = 52/73 (71%), Gaps = 7/73 (9%) Frame = -1 Query: 202 KRFGIRPTIQHYGCMVDLLARVGHLKEAELFVKRMPIEP-------LIWACKMHGDHDRG 44 K+ I+PTIQHYGC+VD+L R G LK+AE F+++MPIEP LIW CK+ GD +R Sbjct: 330 KKHKIKPTIQHYGCVVDMLTRAGRLKDAEEFIRKMPIEPDAVLWRTLIWGCKILGDVERS 389 Query: 43 DGLMNQNQLLQMD 5 + L+ + +LL MD Sbjct: 390 ERLVRELELLNMD 402 >ref|XP_003603974.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355493022|gb|AES74225.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 566 Score = 77.4 bits (189), Expect = 1e-12 Identities = 36/76 (47%), Positives = 53/76 (69%), Gaps = 7/76 (9%) Frame = -1 Query: 214 NNMEKRFGIRPTIQHYGCMVDLLARVGHLKEAELFVKRMPIEP-------LIWACKMHGD 56 N+++KR+ ++P I+H+GCMVDLLA+ G L+EAE F+ MP++P LIWACK+H D Sbjct: 317 NDVQKRYSMKPNIKHFGCMVDLLAKGGCLEEAEDFINAMPMKPDAVIWRTLIWACKVHAD 376 Query: 55 HDRGDGLMNQNQLLQM 8 +R + LM +L M Sbjct: 377 TERAERLMKHLELQGM 392