BLASTX nr result
ID: Coptis23_contig00041685
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00041685 (376 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002279149.2| PREDICTED: pentatricopeptide repeat-containi... 74 1e-11 ref|XP_002306667.1| predicted protein [Populus trichocarpa] gi|2... 73 2e-11 ref|XP_003522561.1| PREDICTED: pentatricopeptide repeat-containi... 62 5e-08 ref|XP_003602633.1| Pentatricopeptide repeat-containing protein ... 61 8e-08 sp|Q9LP03.1|PPR73_ARATH RecName: Full=Pentatricopeptide repeat-c... 60 1e-07 >ref|XP_002279149.2| PREDICTED: pentatricopeptide repeat-containing protein At1g43980, mitochondrial-like [Vitis vinifera] Length = 665 Score = 74.3 bits (181), Expect = 1e-11 Identities = 35/69 (50%), Positives = 48/69 (69%) Frame = -3 Query: 209 ITCYSKLLENSIASKSLDLGNLIHAQLIKTGLTDHTFLGNRLLEVYSKFGVLNESLQVFY 30 ++ YS L+E+ KSLD +HAQLIK G HTFLGNR L++YS+ G N+SL+VF Sbjct: 37 LSYYSNLIEHCFLLKSLDYAKFVHAQLIKVGFNTHTFLGNRCLDLYSQLGTGNDSLRVFE 96 Query: 29 EIPNKNLFT 3 +I +KNL + Sbjct: 97 DIIDKNLIS 105 >ref|XP_002306667.1| predicted protein [Populus trichocarpa] gi|222856116|gb|EEE93663.1| predicted protein [Populus trichocarpa] Length = 630 Score = 73.2 bits (178), Expect = 2e-11 Identities = 34/71 (47%), Positives = 51/71 (71%) Frame = -3 Query: 221 SSNIITCYSKLLENSIASKSLDLGNLIHAQLIKTGLTDHTFLGNRLLEVYSKFGVLNESL 42 S ++ YS L+++ + KSL + HAQLIK GL HTFLGNR L++YS+FG +N++L Sbjct: 12 SRTSLSYYSYLIDHCFSLKSLSFARITHAQLIKVGLNRHTFLGNRCLDLYSQFGNVNDAL 71 Query: 41 QVFYEIPNKNL 9 +VF +I +KN+ Sbjct: 72 KVFDDISSKNI 82 >ref|XP_003522561.1| PREDICTED: pentatricopeptide repeat-containing protein At1g43980, mitochondrial-like [Glycine max] Length = 630 Score = 62.0 bits (149), Expect = 5e-08 Identities = 28/62 (45%), Positives = 45/62 (72%) Frame = -3 Query: 197 SKLLENSIASKSLDLGNLIHAQLIKTGLTDHTFLGNRLLEVYSKFGVLNESLQVFYEIPN 18 S LL + ++ KSL+ ++HA +K GL +T+LGNR L++YS+FG LN++ +VF +I + Sbjct: 19 SLLLNHCLSKKSLNFVKIVHAHFLKLGLNTYTYLGNRCLDLYSEFGHLNDAPKVFDDISH 78 Query: 17 KN 12 KN Sbjct: 79 KN 80 >ref|XP_003602633.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355491681|gb|AES72884.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 647 Score = 61.2 bits (147), Expect = 8e-08 Identities = 39/112 (34%), Positives = 58/112 (51%) Frame = -3 Query: 338 KKCVISSPMIVYSNPLKQFIPYLQFFKRYLFTKPISPKDSSNIITCYSKLLENSIASKSL 159 + C + P + +PL + P L F T D S+ I +S L+ N +++KSL Sbjct: 39 ESCPVKKPRQL--DPLTK--PVLFFLVGERNTVMFHTNDFSSTIEKFSSLISNCVSAKSL 94 Query: 158 DLGNLIHAQLIKTGLTDHTFLGNRLLEVYSKFGVLNESLQVFYEIPNKNLFT 3 G +H+QLIKT L TFL N L+++YSK G + F ++PNK T Sbjct: 95 KHGKALHSQLIKTALFFETFLANGLIDLYSKCGCKESIHKAFDDLPNKTTRT 146 >sp|Q9LP03.1|PPR73_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g43980, mitochondrial; Flags: Precursor gi|8778677|gb|AAF79685.1|AC022314_26 F9C16.15 [Arabidopsis thaliana] Length = 633 Score = 60.5 bits (145), Expect = 1e-07 Identities = 28/66 (42%), Positives = 44/66 (66%) Frame = -3 Query: 200 YSKLLENSIASKSLDLGNLIHAQLIKTGLTDHTFLGNRLLEVYSKFGVLNESLQVFYEIP 21 +S+L+ S+ SKS L ++HAQL++ G T+ GNR L++Y K G + +LQ+F +IP Sbjct: 19 FSRLVNRSLLSKSPTLAKIVHAQLLEAGFVRTTYWGNRCLQLYFKSGSVINALQLFDDIP 78 Query: 20 NKNLFT 3 +KN T Sbjct: 79 DKNTIT 84