BLASTX nr result
ID: Coptis23_contig00041425
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00041425 (282 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002510646.1| conserved hypothetical protein [Ricinus comm... 81 8e-14 ref|XP_002515166.1| conserved hypothetical protein [Ricinus comm... 78 8e-13 ref|XP_002533258.1| conserved hypothetical protein [Ricinus comm... 77 1e-12 ref|XP_002525745.1| conserved hypothetical protein [Ricinus comm... 76 2e-12 ref|XP_002523631.1| conserved hypothetical protein [Ricinus comm... 76 3e-12 >ref|XP_002510646.1| conserved hypothetical protein [Ricinus communis] gi|223551347|gb|EEF52833.1| conserved hypothetical protein [Ricinus communis] Length = 286 Score = 81.3 bits (199), Expect = 8e-14 Identities = 41/90 (45%), Positives = 60/90 (66%) Frame = -1 Query: 270 NIPSRSHPLTLDVEEQLCRLKXXXXXXXXXSLTCHNLSGLSTLYDSMEHLLQSSLAQQKI 91 ++P+RSHPLTL VE L RL+ C+ LSGL LYDS+E LLQ L Q+ + Sbjct: 18 SLPARSHPLTLSVEGHLDRLRLSQETAASP---CNRLSGLKDLYDSVEDLLQLPLTQKDL 74 Query: 90 SSERSNTCINEVVDGSLRLLEICNTARDAF 1 ++E+ ++EV+DGSL+L+++C+T RD F Sbjct: 75 TNEQHRKSVDEVLDGSLKLVDLCSTTRDIF 104 >ref|XP_002515166.1| conserved hypothetical protein [Ricinus communis] gi|223545646|gb|EEF47150.1| conserved hypothetical protein [Ricinus communis] Length = 289 Score = 77.8 bits (190), Expect = 8e-13 Identities = 36/89 (40%), Positives = 58/89 (65%) Frame = -1 Query: 270 NIPSRSHPLTLDVEEQLCRLKXXXXXXXXXSLTCHNLSGLSTLYDSMEHLLQSSLAQQKI 91 ++PSR HPL ++++ LCRL+ + H LSGL L+D ++ LL L QQ + Sbjct: 12 SLPSRPHPLMSELDDHLCRLRACEATSTSSTSISHKLSGLQDLHDCVDKLLLLPLTQQAL 71 Query: 90 SSERSNTCINEVVDGSLRLLEICNTARDA 4 + +++ I+E++DGSLRLL++CN A+DA Sbjct: 72 AQQQNRKWIDELLDGSLRLLDVCNAAKDA 100 >ref|XP_002533258.1| conserved hypothetical protein [Ricinus communis] gi|223526914|gb|EEF29120.1| conserved hypothetical protein [Ricinus communis] Length = 283 Score = 77.4 bits (189), Expect = 1e-12 Identities = 42/90 (46%), Positives = 56/90 (62%) Frame = -1 Query: 270 NIPSRSHPLTLDVEEQLCRLKXXXXXXXXXSLTCHNLSGLSTLYDSMEHLLQSSLAQQKI 91 ++PSRSHPL +EEQL +LK L + LSGL LYD ++ LLQ LAQQ + Sbjct: 10 SLPSRSHPLISGIEEQLHKLKTSESS-----LIGYKLSGLKDLYDCIDDLLQLPLAQQTL 64 Query: 90 SSERSNTCINEVVDGSLRLLEICNTARDAF 1 S E+ + C E +DGSLRLL++C + R F Sbjct: 65 SHEKQSQCAEEALDGSLRLLDMCASTRGFF 94 >ref|XP_002525745.1| conserved hypothetical protein [Ricinus communis] gi|223534959|gb|EEF36644.1| conserved hypothetical protein [Ricinus communis] Length = 287 Score = 76.3 bits (186), Expect = 2e-12 Identities = 35/89 (39%), Positives = 57/89 (64%) Frame = -1 Query: 270 NIPSRSHPLTLDVEEQLCRLKXXXXXXXXXSLTCHNLSGLSTLYDSMEHLLQSSLAQQKI 91 ++PSR HPL ++++ CRL+ + H LSGL L+D ++ LL L QQ + Sbjct: 12 SLPSRPHPLMSELDDHFCRLRACEGTSTSSTSISHKLSGLQDLHDCVDKLLLLPLTQQTL 71 Query: 90 SSERSNTCINEVVDGSLRLLEICNTARDA 4 + +++ I+E++DGSLRLL++CN A+DA Sbjct: 72 AQQQNRKWIDELLDGSLRLLDVCNAAKDA 100 >ref|XP_002523631.1| conserved hypothetical protein [Ricinus communis] gi|223537193|gb|EEF38826.1| conserved hypothetical protein [Ricinus communis] Length = 283 Score = 75.9 bits (185), Expect = 3e-12 Identities = 41/90 (45%), Positives = 55/90 (61%) Frame = -1 Query: 270 NIPSRSHPLTLDVEEQLCRLKXXXXXXXXXSLTCHNLSGLSTLYDSMEHLLQSSLAQQKI 91 ++PSRSHPL +EEQL +LK L + LSGL LYD ++ LLQ L QQ + Sbjct: 10 SLPSRSHPLISGIEEQLHKLKTSESS-----LIGYKLSGLKDLYDCIDDLLQLPLTQQTL 64 Query: 90 SSERSNTCINEVVDGSLRLLEICNTARDAF 1 S E+ + C E +DGSLRLL++C + R F Sbjct: 65 SHEKQSQCAEEALDGSLRLLDMCASTRGFF 94