BLASTX nr result
ID: Coptis23_contig00041203
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00041203 (248 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002281582.2| PREDICTED: pentatricopeptide repeat-containi... 66 3e-09 ref|XP_002309567.1| predicted protein [Populus trichocarpa] gi|2... 61 8e-08 emb|CAN61515.1| hypothetical protein VITISV_033964 [Vitis vinifera] 60 2e-07 ref|XP_002516576.1| pentatricopeptide repeat-containing protein,... 57 2e-06 >ref|XP_002281582.2| PREDICTED: pentatricopeptide repeat-containing protein At5g02860-like [Vitis vinifera] gi|296081891|emb|CBI20896.3| unnamed protein product [Vitis vinifera] Length = 420 Score = 66.2 bits (160), Expect = 3e-09 Identities = 44/94 (46%), Positives = 49/94 (52%), Gaps = 16/94 (17%) Frame = -1 Query: 236 MVLVGRVLSMTSRGLR-------------FLTTSTCSNPLFLKLLQGSTSNIKPTLDCEA 96 M V RVLS+ RGLR F SNPL +KLLQ S S IK LD E Sbjct: 1 MGFVLRVLSVAKRGLRPRLVLIPCRSQRLFCDKPLVSNPLLIKLLQESISRIKTVLDSED 60 Query: 95 E---NQDSLIWEPLLTSLKSSSPQKAQLVLEWKL 3 W+ LLT+LKSSSP KA LVLEW+L Sbjct: 61 NFTFKSSDFSWDILLTTLKSSSPAKAHLVLEWRL 94 >ref|XP_002309567.1| predicted protein [Populus trichocarpa] gi|222855543|gb|EEE93090.1| predicted protein [Populus trichocarpa] Length = 424 Score = 61.2 bits (147), Expect = 8e-08 Identities = 32/63 (50%), Positives = 43/63 (68%), Gaps = 3/63 (4%) Frame = -1 Query: 182 TTSTCSNPLFLKLLQGSTSNIKPTLDCEAE---NQDSLIWEPLLTSLKSSSPQKAQLVLE 12 +T++ S+PL KLLQ TS I TLD + L W+PL+T+L+SSSP+KA LVLE Sbjct: 37 STASSSDPLLSKLLQTPTSKIIITLDSDHSFNLKSSQLSWDPLITNLRSSSPEKAHLVLE 96 Query: 11 WKL 3 W+L Sbjct: 97 WRL 99 >emb|CAN61515.1| hypothetical protein VITISV_033964 [Vitis vinifera] Length = 1331 Score = 60.1 bits (144), Expect = 2e-07 Identities = 33/58 (56%), Positives = 37/58 (63%), Gaps = 3/58 (5%) Frame = -1 Query: 167 SNPLFLKLLQGSTSNIKPTLDCEAE---NQDSLIWEPLLTSLKSSSPQKAQLVLEWKL 3 SNPL +KLLQ S S IK LD E W+ LLT+LKSSSP KA LVLEW+L Sbjct: 948 SNPLLIKLLQESISRIKTVLDSEDNFTFKSSDFSWDILLTTLKSSSPAKAHLVLEWRL 1005 >ref|XP_002516576.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223544396|gb|EEF45917.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 416 Score = 56.6 bits (135), Expect = 2e-06 Identities = 31/60 (51%), Positives = 40/60 (66%) Frame = -1 Query: 182 TTSTCSNPLFLKLLQGSTSNIKPTLDCEAENQDSLIWEPLLTSLKSSSPQKAQLVLEWKL 3 T + SNPL KLLQ S IK TLD + N ++ L+T+L SSSP+KA+LVLEW+L Sbjct: 33 TITNSSNPLLSKLLQLPNSKIKSTLDSDL-NSSQFPFDALVTALASSSPEKARLVLEWRL 91