BLASTX nr result
ID: Coptis23_contig00041167
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00041167 (306 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002528482.1| conserved hypothetical protein [Ricinus comm... 55 8e-06 >ref|XP_002528482.1| conserved hypothetical protein [Ricinus communis] gi|223532091|gb|EEF33899.1| conserved hypothetical protein [Ricinus communis] Length = 92 Score = 54.7 bits (130), Expect = 8e-06 Identities = 31/67 (46%), Positives = 41/67 (61%), Gaps = 6/67 (8%) Frame = -3 Query: 304 LFPHPSLAMRRL------REVDTDSEEGSLKDVENMLLRGEVGHLPRVKLHEVHSGPNPI 143 L P P LA+R+L R + + E +KD ++ GE GH+ R +LHEVHSGPNPI Sbjct: 19 LHPLPCLALRKLEDAQVVRYISSSDLEIFMKDFQSF---GEGGHVHRKELHEVHSGPNPI 75 Query: 142 SNFFPQR 122 SN PQ+ Sbjct: 76 SNTIPQQ 82