BLASTX nr result
ID: Coptis23_contig00041118
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00041118 (288 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN78967.1| hypothetical protein VITISV_027273 [Vitis vinifera] 55 5e-06 >emb|CAN78967.1| hypothetical protein VITISV_027273 [Vitis vinifera] Length = 1163 Score = 55.5 bits (132), Expect = 5e-06 Identities = 26/55 (47%), Positives = 34/55 (61%) Frame = -1 Query: 168 EECISHRPEQLSQQEWV*LVEFWDTPEHQAISKRNWANRAKQITKHAAGRISFPQ 4 EE + RP LS +W L+ FW TPE + IS +N ANRAKQ+ KH + S+ Q Sbjct: 934 EERLCQRPPHLSDDDWRWLIHFWGTPEAKDISDKNKANRAKQVIKHTSRSKSYAQ 988