BLASTX nr result
ID: Coptis23_contig00040899
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00040899 (295 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN80245.1| hypothetical protein VITISV_031023 [Vitis vinifera] 49 3e-07 emb|CAN77360.1| hypothetical protein VITISV_011015 [Vitis vinifera] 45 2e-06 emb|CAN80288.1| hypothetical protein VITISV_006820 [Vitis vinifera] 47 3e-06 emb|CAN69820.1| hypothetical protein VITISV_025709 [Vitis vinifera] 45 4e-06 emb|CAN77206.1| hypothetical protein VITISV_014784 [Vitis vinifera] 47 4e-06 >emb|CAN80245.1| hypothetical protein VITISV_031023 [Vitis vinifera] Length = 1636 Score = 48.5 bits (114), Expect(2) = 3e-07 Identities = 22/55 (40%), Positives = 31/55 (56%) Frame = -2 Query: 231 GKNKTADKLNQRGMNLQNLCLLCKGLEEHIDHLLVNCTLVNDV*RIFFFSFHRPW 67 GK T ++L +RG +L N C LC EE +DHLL++C D+ + F F W Sbjct: 1494 GKVLTQEQLQRRGFSLANRCFLCLSEEETVDHLLLHCVKTRDLWNLLFSLFGISW 1548 Score = 30.8 bits (68), Expect(2) = 3e-07 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = -1 Query: 295 FPQKRIWRKSIPFKVAFF 242 FP +RIWR +P KVAFF Sbjct: 1470 FPSERIWRTRVPPKVAFF 1487 >emb|CAN77360.1| hypothetical protein VITISV_011015 [Vitis vinifera] Length = 1165 Score = 45.4 bits (106), Expect(2) = 2e-06 Identities = 21/55 (38%), Positives = 30/55 (54%) Frame = -2 Query: 231 GKNKTADKLNQRGMNLQNLCLLCKGLEEHIDHLLVNCTLVNDV*RIFFFSFHRPW 67 GK T ++L +RG +L N C LC EE +DHLL++C + + F F W Sbjct: 1001 GKVLTQEQLQRRGFSLANRCFLCLSEEETVDHLLLHCVKTRVLWNLLFSLFXISW 1055 Score = 30.8 bits (68), Expect(2) = 2e-06 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = -1 Query: 295 FPQKRIWRKSIPFKVAFF 242 FP +RIWR +P KVAFF Sbjct: 977 FPSERIWRARVPPKVAFF 994 >emb|CAN80288.1| hypothetical protein VITISV_006820 [Vitis vinifera] Length = 1894 Score = 47.4 bits (111), Expect(2) = 3e-06 Identities = 23/55 (41%), Positives = 31/55 (56%) Frame = -2 Query: 231 GKNKTADKLNQRGMNLQNLCLLCKGLEEHIDHLLVNCTLVNDV*RIFFFSFHRPW 67 GK T DKL +RG L N C LC EE+ +H+L++CT+V + I F W Sbjct: 1799 GKILTLDKLQRRGXQLPNRCYLCGCEEENANHILLHCTVVKTIWEITLVIFXVQW 1853 Score = 28.5 bits (62), Expect(2) = 3e-06 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = -1 Query: 295 FPQKRIWRKSIPFKVAFF 242 FP +RIW +P KV+FF Sbjct: 1775 FPNRRIWMDRVPTKVSFF 1792 >emb|CAN69820.1| hypothetical protein VITISV_025709 [Vitis vinifera] Length = 779 Score = 44.7 bits (104), Expect(2) = 4e-06 Identities = 21/55 (38%), Positives = 30/55 (54%) Frame = -2 Query: 231 GKNKTADKLNQRGMNLQNLCLLCKGLEEHIDHLLVNCTLVNDV*RIFFFSFHRPW 67 GK T ++L +RG +L N C LC EE +DHLL++C + + F F W Sbjct: 572 GKVLTQEQLQRRGFSLANRCFLCLSEEETVDHLLLHCIKTRVLWNLLFSLFGISW 626 Score = 30.8 bits (68), Expect(2) = 4e-06 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = -1 Query: 295 FPQKRIWRKSIPFKVAFF 242 FP +RIWR +P KVAFF Sbjct: 548 FPSERIWRARVPPKVAFF 565 >emb|CAN77206.1| hypothetical protein VITISV_014784 [Vitis vinifera] Length = 477 Score = 46.6 bits (109), Expect(2) = 4e-06 Identities = 23/55 (41%), Positives = 31/55 (56%) Frame = -2 Query: 231 GKNKTADKLNQRGMNLQNLCLLCKGLEEHIDHLLVNCTLVNDV*RIFFFSFHRPW 67 GK T DKL +RG L N C LC EE+ +H+L++CT+V + I F W Sbjct: 289 GKILTLDKLQRRGWQLPNRCYLCGCEEENANHILLHCTVVKTIWEITLAIFGVQW 343 Score = 28.9 bits (63), Expect(2) = 4e-06 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = -1 Query: 295 FPQKRIWRKSIPFKVAFF 242 FP +RIW +P KV+FF Sbjct: 265 FPNRRIWMDKVPTKVSFF 282