BLASTX nr result
ID: Coptis23_contig00040843
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00040843 (262 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAM11099.1| ABC protein [Coptis japonica] 74 1e-11 ref|XP_002515184.1| multidrug resistance protein 1, 2, putative ... 57 2e-06 >dbj|BAM11099.1| ABC protein [Coptis japonica] Length = 1288 Score = 74.3 bits (181), Expect = 1e-11 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -1 Query: 262 SIAVIKNGVIIEKGRHEDLINIKNGVYSFLVAHQMSS 152 SIAVIKNGVIIEKGRHEDL+NIKNGVYSFLVAHQMSS Sbjct: 1252 SIAVIKNGVIIEKGRHEDLLNIKNGVYSFLVAHQMSS 1288 >ref|XP_002515184.1| multidrug resistance protein 1, 2, putative [Ricinus communis] gi|223545664|gb|EEF47168.1| multidrug resistance protein 1, 2, putative [Ricinus communis] Length = 1301 Score = 56.6 bits (135), Expect = 2e-06 Identities = 27/36 (75%), Positives = 32/36 (88%) Frame = -1 Query: 259 IAVIKNGVIIEKGRHEDLINIKNGVYSFLVAHQMSS 152 IAV+KNGVI+EKGRHE LINIK+GVY+ LVA MS+ Sbjct: 1263 IAVVKNGVIVEKGRHETLINIKDGVYASLVALHMSA 1298