BLASTX nr result
ID: Coptis23_contig00040788
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00040788 (274 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|ZP_06710336.1| hypothetical protein SSTG_03777 [Streptomyces... 64 2e-08 ref|ZP_07312206.1| hypothetical protein SSRG_03379 [Streptomyces... 63 2e-08 ref|ZP_07273396.1| conserved hypothetical protein [Streptomyces ... 52 6e-08 ref|ZP_06706815.1| hypothetical protein SSTG_00255 [Streptomyces... 60 2e-07 ref|ZP_08152177.1| hypothetical protein HMPREF0490_02918, partia... 56 3e-06 >ref|ZP_06710336.1| hypothetical protein SSTG_03777 [Streptomyces sp. e14] gi|292835109|gb|EFF93458.1| hypothetical protein SSTG_03777 [Streptomyces sp. e14] Length = 86 Score = 63.5 bits (153), Expect = 2e-08 Identities = 37/73 (50%), Positives = 47/73 (64%) Frame = +2 Query: 44 VWGITLSGPLKIIALVSRYLTN*LILRVPISIRRSFQY*TMPFNILWSINLPFERLSPR* 223 +W + LSG L ++ALVSRYLTN LI R I RRSF MP+ ++ I F+ LS Sbjct: 1 MWPVALSGRLPVVALVSRYLTNKLIGRGLILHRRSFPASKMPWRLVSGIRPRFQGLSQSE 60 Query: 224 RQVAHVLRTRTPL 262 Q+AHVL TR+PL Sbjct: 61 GQIAHVLLTRSPL 73 >ref|ZP_07312206.1| hypothetical protein SSRG_03379 [Streptomyces griseoflavus Tu4000] gi|302477482|gb|EFL40575.1| hypothetical protein SSRG_03379 [Streptomyces griseoflavus Tu4000] Length = 86 Score = 63.2 bits (152), Expect = 2e-08 Identities = 37/73 (50%), Positives = 46/73 (63%) Frame = +2 Query: 44 VWGITLSGPLKIIALVSRYLTN*LILRVPISIRRSFQY*TMPFNILWSINLPFERLSPR* 223 +W + LSG L ++ALVS YLTN LI R I RRSFQ MP ++ I F+ LS Sbjct: 1 MWPVALSGRLPVVALVSHYLTNKLIGRGLILHRRSFQPLQMPAGVISGIRPRFQGLSQSE 60 Query: 224 RQVAHVLRTRTPL 262 Q+AHVL TR+PL Sbjct: 61 GQIAHVLLTRSPL 73 >ref|ZP_07273396.1| conserved hypothetical protein [Streptomyces sp. SPB78] gi|302429949|gb|EFL01765.1| conserved hypothetical protein [Streptomyces sp. SPB78] Length = 69 Score = 52.0 bits (123), Expect(2) = 6e-08 Identities = 25/37 (67%), Positives = 26/37 (70%) Frame = +1 Query: 58 PLRPPKDHRLGEPLPHQLANLARAHLYPPELSILNDA 168 PLRP RLGEPLPHQLA+ RAH PPELS DA Sbjct: 2 PLRPATRRRLGEPLPHQLADRPRAHPAPPELSTAKDA 38 Score = 29.6 bits (65), Expect(2) = 6e-08 Identities = 14/26 (53%), Positives = 18/26 (69%) Frame = +3 Query: 180 YGVLIFLSKGYPPDKGRLHTCYAPVR 257 Y VL +S+ P +GRL TCY+PVR Sbjct: 43 YPVLDPVSRACPRVQGRLPTCYSPVR 68 >ref|ZP_06706815.1| hypothetical protein SSTG_00255 [Streptomyces sp. e14] gi|292831588|gb|EFF89937.1| hypothetical protein SSTG_00255 [Streptomyces sp. e14] Length = 86 Score = 60.1 bits (144), Expect = 2e-07 Identities = 36/73 (49%), Positives = 45/73 (61%) Frame = +2 Query: 44 VWGITLSGPLKIIALVSRYLTN*LILRVPISIRRSFQY*TMPFNILWSINLPFERLSPR* 223 +W + LSG L ++ALVS YLTN LI R I RRSF MP ++ I F+ LS Sbjct: 1 MWPVALSGRLPVVALVSHYLTNKLIGRGLILHRRSFPASKMPRRLVSGIRPRFQGLSQSE 60 Query: 224 RQVAHVLRTRTPL 262 Q+AHVL TR+PL Sbjct: 61 GQIAHVLLTRSPL 73 >ref|ZP_08152177.1| hypothetical protein HMPREF0490_02918, partial [Lachnospiraceae bacterium 4_1_37FAA] gi|325470109|gb|EGC73343.1| hypothetical protein HMPREF0490_02918 [Lachnospiraceae bacterium 4_1_37FAA] Length = 58 Score = 56.2 bits (134), Expect = 3e-06 Identities = 25/39 (64%), Positives = 27/39 (69%) Frame = +1 Query: 55 HPLRPPKDHRLGEPLPHQLANLARAHLYPPELSILNDAV 171 HPLRP D RLG PLPHQLAN R HL PPE L+ A+ Sbjct: 3 HPLRPATDRRLGGPLPHQLANQTRVHLIPPEFFTLDHAI 41