BLASTX nr result
ID: Coptis23_contig00040749
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00040749 (244 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCJ47163.1| putative oligopeptide transporter, partial [Hord... 65 6e-09 dbj|BAJ90957.1| predicted protein [Hordeum vulgare subsp. vulgare] 65 6e-09 ref|XP_003570149.1| PREDICTED: oligopeptide transporter 4-like i... 64 1e-08 ref|XP_003570148.1| PREDICTED: oligopeptide transporter 4-like i... 64 1e-08 ref|XP_002518328.1| Oligopeptide transporter, putative [Ricinus ... 64 2e-08 >emb|CCJ47163.1| putative oligopeptide transporter, partial [Hordeum vulgare subsp. vulgare] Length = 657 Score = 65.1 bits (157), Expect = 6e-09 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = +2 Query: 2 LCTVLNDQVQMPWWALIAACVLAFLFTPAISIITATTNQ 118 LCTVL DQVQ+PWW L+ AC +AF+FT ISIITATTNQ Sbjct: 351 LCTVLKDQVQLPWWGLLFACGMAFVFTLPISIITATTNQ 389 >dbj|BAJ90957.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 749 Score = 65.1 bits (157), Expect = 6e-09 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = +2 Query: 2 LCTVLNDQVQMPWWALIAACVLAFLFTPAISIITATTNQ 118 LCTVL DQVQ+PWW L+ AC +AF+FT ISIITATTNQ Sbjct: 443 LCTVLKDQVQLPWWGLLFACGMAFVFTLPISIITATTNQ 481 >ref|XP_003570149.1| PREDICTED: oligopeptide transporter 4-like isoform 2 [Brachypodium distachyon] Length = 719 Score = 64.3 bits (155), Expect = 1e-08 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = +2 Query: 2 LCTVLNDQVQMPWWALIAACVLAFLFTPAISIITATTNQ 118 LCTVLNDQVQ+P+W L+ AC +AF+FT ISIITATTNQ Sbjct: 446 LCTVLNDQVQLPYWGLLLACGMAFVFTLPISIITATTNQ 484 >ref|XP_003570148.1| PREDICTED: oligopeptide transporter 4-like isoform 1 [Brachypodium distachyon] Length = 753 Score = 64.3 bits (155), Expect = 1e-08 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = +2 Query: 2 LCTVLNDQVQMPWWALIAACVLAFLFTPAISIITATTNQ 118 LCTVLNDQVQ+P+W L+ AC +AF+FT ISIITATTNQ Sbjct: 446 LCTVLNDQVQLPYWGLLLACGMAFVFTLPISIITATTNQ 484 >ref|XP_002518328.1| Oligopeptide transporter, putative [Ricinus communis] gi|223542548|gb|EEF44088.1| Oligopeptide transporter, putative [Ricinus communis] Length = 754 Score = 63.5 bits (153), Expect = 2e-08 Identities = 30/39 (76%), Positives = 31/39 (79%) Frame = +2 Query: 2 LCTVLNDQVQMPWWALIAACVLAFLFTPAISIITATTNQ 118 LC LNDQVQMPWWALI A +AF FT ISIITATTNQ Sbjct: 451 LCIFLNDQVQMPWWALIFASAMAFFFTLPISIITATTNQ 489