BLASTX nr result
ID: Coptis23_contig00040713
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00040713 (324 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002317422.1| predicted protein [Populus trichocarpa] gi|2... 91 7e-17 emb|CAN75015.1| hypothetical protein VITISV_035367 [Vitis vinifera] 85 7e-15 ref|NP_178003.1| D-mannose binding lectin protein with Apple-lik... 83 2e-14 ref|NP_565191.1| curculin-like (mannose-binding) lectin-like pro... 83 2e-14 dbj|BAD24818.1| cell attachment protein in somatic embryogenesis... 83 2e-14 >ref|XP_002317422.1| predicted protein [Populus trichocarpa] gi|222860487|gb|EEE98034.1| predicted protein [Populus trichocarpa] Length = 414 Score = 91.3 bits (225), Expect = 7e-17 Identities = 40/69 (57%), Positives = 53/69 (76%), Gaps = 1/69 (1%) Frame = -1 Query: 324 YKIVGVEHFSSNFS-GNGPIKLLDCKAKCSKDCTCLGFFYRKTTSTCLLTPQLSTLTRVS 148 YK+VGVEHF + ++ G GP+KL+DC+ KC+ DC CLGFFY++ +S CLL P L TL VS Sbjct: 346 YKVVGVEHFLNGYNEGEGPMKLVDCRNKCNNDCGCLGFFYKEESSKCLLAPVLGTLVGVS 405 Query: 147 NSSHLAFIK 121 + SH+ FIK Sbjct: 406 SPSHVGFIK 414 >emb|CAN75015.1| hypothetical protein VITISV_035367 [Vitis vinifera] Length = 444 Score = 84.7 bits (208), Expect = 7e-15 Identities = 37/69 (53%), Positives = 51/69 (73%), Gaps = 1/69 (1%) Frame = -1 Query: 324 YKIVGVEHFSSNFS-GNGPIKLLDCKAKCSKDCTCLGFFYRKTTSTCLLTPQLSTLTRVS 148 YK+ GV+HF+S +S G+GP+K C KC++DC CLG+FY TS C + L+TLT+V Sbjct: 371 YKLEGVDHFTSKYSKGDGPMKEKQCSDKCTRDCKCLGYFYHTLTSRCWIAYDLNTLTKVQ 430 Query: 147 NSSHLAFIK 121 NS+HLA+IK Sbjct: 431 NSTHLAYIK 439 >ref|NP_178003.1| D-mannose binding lectin protein with Apple-like carbohydrate-binding domain [Arabidopsis thaliana] gi|3834328|gb|AAC83044.1| Strong similarity to glycoprotein EP1 gb|L16983 Daucus carota and a member of S locus glycoprotein family PF|00954 [Arabidopsis thaliana] gi|14334886|gb|AAK59621.1| putative glycoprotein EP1 [Arabidopsis thaliana] gi|15810615|gb|AAL07195.1| putative glycoprotein EP1 [Arabidopsis thaliana] gi|17065264|gb|AAL32786.1| Strong similarity to glycoprotein EP1 [comment= [Arabidopsis thaliana] gi|20260038|gb|AAM13366.1| strong similarity to glycoprotein EP1 [Arabidopsis thaliana] gi|332198038|gb|AEE36159.1| D-mannose binding lectin protein with Apple-like carbohydrate-binding domain [Arabidopsis thaliana] Length = 455 Score = 83.2 bits (204), Expect = 2e-14 Identities = 37/70 (52%), Positives = 49/70 (70%), Gaps = 2/70 (2%) Frame = -1 Query: 324 YKIVGVEHFSSNF--SGNGPIKLLDCKAKCSKDCTCLGFFYRKTTSTCLLTPQLSTLTRV 151 YKIVGVEHF+ + G GP + DCKAKC +DC CLG+FY++ CLL P L TL + Sbjct: 385 YKIVGVEHFTGPYVNDGQGPTSVNDCKAKCDRDCKCLGYFYKEKDKKCLLAPLLGTLIKD 444 Query: 150 SNSSHLAFIK 121 +N+S +A+IK Sbjct: 445 ANTSSVAYIK 454 >ref|NP_565191.1| curculin-like (mannose-binding) lectin-like protein [Arabidopsis thaliana] gi|16226591|gb|AAL16208.1|AF428439_1 At1g78830/F9K20_12 [Arabidopsis thaliana] gi|3834312|gb|AAC83028.1| Strong similarity to glycoprotein EP1 gb|L16983 Daucus carota and a member of S locus glycoprotein family PF|00954. ESTs gb|AA067487, gb|Z35737, gb|Z30815, gb|Z35350, gb|AA713171, gb|AI100553, gb|Z34248, gb|AA728536, gb|Z30816 and gb|Z35351 come from this gene [Arabidopsis thaliana] gi|23297392|gb|AAN12959.1| unknown protein [Arabidopsis thaliana] gi|332198039|gb|AEE36160.1| curculin-like (mannose-binding) lectin-like protein [Arabidopsis thaliana] Length = 455 Score = 83.2 bits (204), Expect = 2e-14 Identities = 37/70 (52%), Positives = 49/70 (70%), Gaps = 2/70 (2%) Frame = -1 Query: 324 YKIVGVEHFSSNF--SGNGPIKLLDCKAKCSKDCTCLGFFYRKTTSTCLLTPQLSTLTRV 151 YKIVGVEHF+ + G GP + DCKAKC +DC CLG+FY++ CLL P L TL + Sbjct: 385 YKIVGVEHFTGPYVNDGQGPTSVNDCKAKCDRDCKCLGYFYKEKDKKCLLAPLLGTLIKD 444 Query: 150 SNSSHLAFIK 121 +N+S +A+IK Sbjct: 445 ANTSSVAYIK 454 >dbj|BAD24818.1| cell attachment protein in somatic embryogenesis [Daucus carota] gi|55785663|dbj|BAD72577.1| cell attachment protein in somatic embryogenesis [Daucus carota] Length = 443 Score = 83.2 bits (204), Expect = 2e-14 Identities = 36/72 (50%), Positives = 51/72 (70%), Gaps = 1/72 (1%) Frame = -1 Query: 324 YKIVGVEHFSSNFSGNGPIKLL-DCKAKCSKDCTCLGFFYRKTTSTCLLTPQLSTLTRVS 148 YK+ GVEHF++ + P L DC+ KC DC C+GFFYR+ +STCLL L L +V+ Sbjct: 372 YKVAGVEHFTNGVTSGTPRSTLADCRKKCDSDCKCVGFFYREESSTCLLASVLGALNQVA 431 Query: 147 NSSHLAFIKIAK 112 N+SH+A+IK++K Sbjct: 432 NASHVAYIKMSK 443