BLASTX nr result
ID: Coptis23_contig00040704
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00040704 (320 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002307210.1| predicted protein [Populus trichocarpa] gi|2... 70 1e-10 ref|XP_004159759.1| PREDICTED: probable serine/threonine-protein... 70 2e-10 ref|XP_003631561.1| PREDICTED: probable serine/threonine-protein... 70 2e-10 ref|XP_002279800.2| PREDICTED: probable serine/threonine-protein... 70 2e-10 ref|XP_002272452.2| PREDICTED: probable serine/threonine-protein... 70 2e-10 >ref|XP_002307210.1| predicted protein [Populus trichocarpa] gi|222856659|gb|EEE94206.1| predicted protein [Populus trichocarpa] Length = 437 Score = 70.5 bits (171), Expect = 1e-10 Identities = 33/42 (78%), Positives = 37/42 (88%) Frame = -3 Query: 255 LGRLSHPNLVKFLGYCCKDEKLLLVYEFMEKGSLECHLFSSK 130 LGRLSHPNLVK LG+C +D++LLLVYEFM KGSLE HLF SK Sbjct: 151 LGRLSHPNLVKLLGFCWEDKELLLVYEFMPKGSLENHLFRSK 192 >ref|XP_004159759.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic-like [Cucumis sativus] Length = 365 Score = 70.1 bits (170), Expect = 2e-10 Identities = 32/41 (78%), Positives = 36/41 (87%) Frame = -3 Query: 255 LGRLSHPNLVKFLGYCCKDEKLLLVYEFMEKGSLECHLFSS 133 LGRL+HPNLVK LG+C +DE+LLLVYEFM KGSLE HLF S Sbjct: 127 LGRLNHPNLVKLLGFCWEDEELLLVYEFMSKGSLESHLFRS 167 >ref|XP_003631561.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic-like isoform 2 [Vitis vinifera] Length = 417 Score = 70.1 bits (170), Expect = 2e-10 Identities = 32/39 (82%), Positives = 36/39 (92%) Frame = -3 Query: 255 LGRLSHPNLVKFLGYCCKDEKLLLVYEFMEKGSLECHLF 139 LGRLSHPNLVK LGYC +D++LLLVYEFM+KGSLE HLF Sbjct: 140 LGRLSHPNLVKLLGYCWEDKELLLVYEFMQKGSLENHLF 178 >ref|XP_002279800.2| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic-like isoform 1 [Vitis vinifera] Length = 415 Score = 70.1 bits (170), Expect = 2e-10 Identities = 32/39 (82%), Positives = 36/39 (92%) Frame = -3 Query: 255 LGRLSHPNLVKFLGYCCKDEKLLLVYEFMEKGSLECHLF 139 LGRLSHPNLVK LGYC +D++LLLVYEFM+KGSLE HLF Sbjct: 138 LGRLSHPNLVKLLGYCWEDKELLLVYEFMQKGSLENHLF 176 >ref|XP_002272452.2| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic-like [Vitis vinifera] gi|297745554|emb|CBI40719.3| unnamed protein product [Vitis vinifera] Length = 418 Score = 70.1 bits (170), Expect = 2e-10 Identities = 30/49 (61%), Positives = 38/49 (77%) Frame = -3 Query: 261 QLLGRLSHPNLVKFLGYCCKDEKLLLVYEFMEKGSLECHLFSSKGEKKL 115 + LG+ +HPNLVK LGYCC+D++ LLVYE+M KGSLE HLF G + L Sbjct: 137 KFLGKFTHPNLVKLLGYCCEDQQFLLVYEYMHKGSLENHLFKLGGAESL 185