BLASTX nr result
ID: Coptis23_contig00040644
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00040644 (442 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003595495.1| BTB/POZ domain-containing protein [Medicago ... 45 6e-06 ref|XP_003533834.1| PREDICTED: BTB/POZ domain-containing protein... 45 6e-06 ref|XP_003577427.1| PREDICTED: BTB/POZ domain-containing protein... 47 8e-06 >ref|XP_003595495.1| BTB/POZ domain-containing protein [Medicago truncatula] gi|124360049|gb|ABN08065.1| BTB/POZ; Superoxide dismutase, copper/zinc binding; NPH3 [Medicago truncatula] gi|355484543|gb|AES65746.1| BTB/POZ domain-containing protein [Medicago truncatula] Length = 647 Score = 45.1 bits (105), Expect(2) = 6e-06 Identities = 20/31 (64%), Positives = 25/31 (80%) Frame = -1 Query: 442 LKAHPCVTESEKEQLR*LLDCQKLSLKHCPH 350 LK+HP + ESE+EQL L+DCQKLSL+ C H Sbjct: 451 LKSHPWLVESEREQLCRLMDCQKLSLEACTH 481 Score = 29.6 bits (65), Expect(2) = 6e-06 Identities = 12/16 (75%), Positives = 15/16 (93%) Frame = -2 Query: 324 VFFQQLQ*KTSIAGCF 277 +FF+QLQ +TSIAGCF Sbjct: 497 LFFEQLQLRTSIAGCF 512 >ref|XP_003533834.1| PREDICTED: BTB/POZ domain-containing protein At1g30440-like [Glycine max] Length = 643 Score = 45.1 bits (105), Expect(2) = 6e-06 Identities = 20/31 (64%), Positives = 25/31 (80%) Frame = -1 Query: 442 LKAHPCVTESEKEQLR*LLDCQKLSLKHCPH 350 LK+HP + ESE+EQL L+DCQKLSL+ C H Sbjct: 450 LKSHPWLVESEREQLCRLMDCQKLSLEACTH 480 Score = 29.6 bits (65), Expect(2) = 6e-06 Identities = 12/16 (75%), Positives = 15/16 (93%) Frame = -2 Query: 324 VFFQQLQ*KTSIAGCF 277 +FF+QLQ +TSIAGCF Sbjct: 496 LFFEQLQLRTSIAGCF 511 >ref|XP_003577427.1| PREDICTED: BTB/POZ domain-containing protein At1g30440-like [Brachypodium distachyon] Length = 637 Score = 47.0 bits (110), Expect(2) = 8e-06 Identities = 21/31 (67%), Positives = 25/31 (80%) Frame = -1 Query: 442 LKAHPCVTESEKEQLR*LLDCQKLSLKHCPH 350 LKAH C+ ESE+EQL L+DCQKLSL+ C H Sbjct: 444 LKAHSCLPESEREQLCRLIDCQKLSLEACTH 474 Score = 27.3 bits (59), Expect(2) = 8e-06 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = -2 Query: 324 VFFQQLQ*KTSIAGC 280 +FF+QLQ +TSIAGC Sbjct: 490 LFFEQLQLRTSIAGC 504