BLASTX nr result
ID: Coptis23_contig00040632
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00040632 (370 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002534950.1| conserved hypothetical protein [Ricinus comm... 92 4e-17 >ref|XP_002534950.1| conserved hypothetical protein [Ricinus communis] gi|223524316|gb|EEF27435.1| conserved hypothetical protein [Ricinus communis] Length = 147 Score = 92.0 bits (227), Expect = 4e-17 Identities = 47/98 (47%), Positives = 62/98 (63%) Frame = +2 Query: 77 SKPPTGTGVMEQAGPSQTPPSGGNHSSSSVTTEDFRKILENHTAVSNVLQEIHRNLHTRV 256 S P +ME+ P PP + + EDF +LE+H +S ++++ R+LHTRV Sbjct: 15 SDPYRSAALMEERTPVAQPPIQ-ERPVNQPSLEDFANLLESHERISERIKDLFRDLHTRV 73 Query: 257 PAGYQAERLAEILEDRHGPLKMGDILHSLQTEGSRSPY 370 P G+QAERL EILE+RHG KM +IL SLQTEG SPY Sbjct: 74 PGGFQAERLTEILEERHGGEKMNEILQSLQTEGLHSPY 111