BLASTX nr result
ID: Coptis23_contig00040561
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00040561 (301 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002264733.2| PREDICTED: cyanidin-3-O-glucoside 2-O-glucur... 88 8e-16 emb|CBI37520.3| unnamed protein product [Vitis vinifera] 88 8e-16 ref|XP_002523035.1| glucosyl/glucuronosyl transferases, putative... 84 9e-15 ref|XP_002264771.1| PREDICTED: cyanidin-3-O-glucoside 2-O-glucur... 84 2e-14 ref|XP_002270285.1| PREDICTED: flavanone 7-O-glucoside 2''-O-bet... 83 2e-14 >ref|XP_002264733.2| PREDICTED: cyanidin-3-O-glucoside 2-O-glucuronosyltransferase-like [Vitis vinifera] Length = 689 Score = 87.8 bits (216), Expect = 8e-16 Identities = 38/50 (76%), Positives = 46/50 (92%) Frame = +3 Query: 144 LHVLLFPWLAHGHISPFLELAKKLTQRNFYIYFCSTPINLSSIKNQVSSE 293 + V+L PWLAHGHISPFLELAKKL++RNFYIYFCSTP+NLSSIK +++ E Sbjct: 7 MKVVLLPWLAHGHISPFLELAKKLSRRNFYIYFCSTPVNLSSIKGKLTEE 56 >emb|CBI37520.3| unnamed protein product [Vitis vinifera] Length = 339 Score = 87.8 bits (216), Expect = 8e-16 Identities = 38/50 (76%), Positives = 46/50 (92%) Frame = +3 Query: 144 LHVLLFPWLAHGHISPFLELAKKLTQRNFYIYFCSTPINLSSIKNQVSSE 293 + V+L PWLAHGHISPFLELAKKL++RNFYIYFCSTP+NLSSIK +++ E Sbjct: 7 MKVVLLPWLAHGHISPFLELAKKLSRRNFYIYFCSTPVNLSSIKGKLTEE 56 >ref|XP_002523035.1| glucosyl/glucuronosyl transferases, putative [Ricinus communis] gi|223537718|gb|EEF39339.1| glucosyl/glucuronosyl transferases, putative [Ricinus communis] Length = 420 Score = 84.3 bits (207), Expect = 9e-15 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 150 VLLFPWLAHGHISPFLELAKKLTQRNFYIYFCSTPINLSSIKNQVS 287 VL+FPWLAHGHISPFLELAKKL +RNFY+Y CSTP+NL SIK +S Sbjct: 12 VLMFPWLAHGHISPFLELAKKLAKRNFYVYLCSTPVNLDSIKQNLS 57 >ref|XP_002264771.1| PREDICTED: cyanidin-3-O-glucoside 2-O-glucuronosyltransferase [Vitis vinifera] Length = 457 Score = 83.6 bits (205), Expect = 2e-14 Identities = 35/50 (70%), Positives = 44/50 (88%) Frame = +3 Query: 144 LHVLLFPWLAHGHISPFLELAKKLTQRNFYIYFCSTPINLSSIKNQVSSE 293 + V++ PWLAHGHISPFLELAKKL++RNFYIYFCSTP+NL IK +++ E Sbjct: 9 ISVVMLPWLAHGHISPFLELAKKLSRRNFYIYFCSTPVNLGCIKGKLNQE 58 >ref|XP_002270285.1| PREDICTED: flavanone 7-O-glucoside 2''-O-beta-L-rhamnosyltransferase [Vitis vinifera] Length = 453 Score = 83.2 bits (204), Expect = 2e-14 Identities = 36/54 (66%), Positives = 42/54 (77%) Frame = +3 Query: 123 MDSKEYDLHVLLFPWLAHGHISPFLELAKKLTQRNFYIYFCSTPINLSSIKNQV 284 MD+K VL+ PWL HGHISPFLELAKKL QRNFYIY CSTPINL +++ + Sbjct: 1 MDAKHQSRRVLMLPWLGHGHISPFLELAKKLAQRNFYIYLCSTPINLKPLRDNL 54