BLASTX nr result
ID: Coptis23_contig00040411
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00040411 (269 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002317632.1| predicted protein [Populus trichocarpa] gi|2... 58 9e-07 ref|XP_003631927.1| PREDICTED: uncharacterized protein LOC100854... 57 2e-06 ref|XP_002528523.1| conserved hypothetical protein [Ricinus comm... 55 5e-06 ref|XP_002334939.1| predicted protein [Populus trichocarpa] gi|2... 55 6e-06 >ref|XP_002317632.1| predicted protein [Populus trichocarpa] gi|222860697|gb|EEE98244.1| predicted protein [Populus trichocarpa] Length = 129 Score = 57.8 bits (138), Expect = 9e-07 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = +3 Query: 51 YRLRQYGRSNSFYSEAIADCLEFIKRTSVSTDDDE 155 YR R +GRSNSFYSEAIADCLEFIKR+S+S + + Sbjct: 91 YRFRSFGRSNSFYSEAIADCLEFIKRSSISVEQKQ 125 >ref|XP_003631927.1| PREDICTED: uncharacterized protein LOC100854263 [Vitis vinifera] Length = 125 Score = 56.6 bits (135), Expect = 2e-06 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = +3 Query: 54 RLRQYGRSNSFYSEAIADCLEFIKRTSVSTDD 149 R R +GR+NSFYSEAIADCLEFIKR+S+S DD Sbjct: 84 RFRSFGRTNSFYSEAIADCLEFIKRSSLSVDD 115 >ref|XP_002528523.1| conserved hypothetical protein [Ricinus communis] gi|223532025|gb|EEF33835.1| conserved hypothetical protein [Ricinus communis] Length = 127 Score = 55.5 bits (132), Expect = 5e-06 Identities = 24/34 (70%), Positives = 30/34 (88%) Frame = +3 Query: 54 RLRQYGRSNSFYSEAIADCLEFIKRTSVSTDDDE 155 R+R +GRSNSFYSEAIADCLEFIKR+S+S + + Sbjct: 90 RMRTFGRSNSFYSEAIADCLEFIKRSSISVEQKQ 123 >ref|XP_002334939.1| predicted protein [Populus trichocarpa] gi|222832473|gb|EEE70950.1| predicted protein [Populus trichocarpa] Length = 144 Score = 55.1 bits (131), Expect = 6e-06 Identities = 24/35 (68%), Positives = 29/35 (82%) Frame = +3 Query: 51 YRLRQYGRSNSFYSEAIADCLEFIKRTSVSTDDDE 155 Y R +GRSNSFYSEAIADCLEFIKR+S+S + + Sbjct: 106 YSCRSFGRSNSFYSEAIADCLEFIKRSSISVEQKQ 140