BLASTX nr result
ID: Coptis23_contig00040157
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00040157 (488 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCA66035.1| hypothetical protein [Beta vulgaris subsp. vulga... 60 2e-07 ref|XP_002526851.1| conserved hypothetical protein [Ricinus comm... 55 6e-06 >emb|CCA66035.1| hypothetical protein [Beta vulgaris subsp. vulgaris] Length = 465 Score = 59.7 bits (143), Expect = 2e-07 Identities = 30/101 (29%), Positives = 58/101 (57%), Gaps = 4/101 (3%) Frame = +3 Query: 18 KERFNYEDVKSASREVGSFMELDRNGITVLNSPAARVKVSLNIRELVKETI-LEFDNKSR 194 K R N +VK+ ++GSF+ +D++G ++ + R++V ++R+ + +I + + Sbjct: 160 KGRLNINNVKAIGNKIGSFITMDKSGAMGIDK-SIRIRVMHDVRKPLSSSIKVRMKSGEE 218 Query: 195 IPVKFKYERLPFFCFFCGIIGHEMKNC---SVKEKYIARFG 308 KYER P FCF+CG +GH K+C ++K + ++G Sbjct: 219 DIFTVKYERPPLFCFYCGKVGHGTKDCEEDDAEDKGVVKYG 259 >ref|XP_002526851.1| conserved hypothetical protein [Ricinus communis] gi|223533750|gb|EEF35482.1| conserved hypothetical protein [Ricinus communis] Length = 335 Score = 55.1 bits (131), Expect = 6e-06 Identities = 29/99 (29%), Positives = 56/99 (56%), Gaps = 1/99 (1%) Frame = +3 Query: 36 EDVKSASREVGSFMELDRNGITVLNSPAARVKVSLNIRE-LVKETILEFDNKSRIPVKFK 212 E +K+ +G+ +++D + L + R+++ +++R+ L K T + + + V F+ Sbjct: 7 EAIKAIGARIGTVLDIDDTSMEGLER-SVRLRIRIDLRKPLRKRTKIAMGSNKDMWVFFR 65 Query: 213 YERLPFFCFFCGIIGHEMKNCSVKEKYIARFGYDYSETK 329 YERLP FC+ CG +GH M++C + + GYD + K Sbjct: 66 YERLPSFCYVCGCLGHVMRDCDSRTE---DDGYDAMDEK 101