BLASTX nr result
ID: Coptis23_contig00040142
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00040142 (227 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN61058.1| hypothetical protein VITISV_011618 [Vitis vinifera] 77 1e-15 ref|XP_002268090.1| PREDICTED: pentatricopeptide repeat-containi... 75 1e-14 ref|XP_002283791.1| PREDICTED: pentatricopeptide repeat-containi... 65 4e-09 emb|CAN72397.1| hypothetical protein VITISV_041201 [Vitis vinifera] 65 4e-09 ref|XP_002533966.1| pentatricopeptide repeat-containing protein,... 63 3e-08 >emb|CAN61058.1| hypothetical protein VITISV_011618 [Vitis vinifera] Length = 529 Score = 77.0 bits (188), Expect(2) = 1e-15 Identities = 33/59 (55%), Positives = 42/59 (71%) Frame = +3 Query: 3 KLGTFELGEWIDNYVKKNGFEGNDICMSNALINMHAKCGNIKKACQVLDQMEEKALLPW 179 KL +FELGEWI YV K G ++N L++MHAKCGNIK+ACQ+ D MEEK ++ W Sbjct: 293 KLRSFELGEWISQYVVKTGLVKESPAIANVLMDMHAKCGNIKRACQIFDGMEEKTIVSW 351 Score = 30.8 bits (68), Expect(2) = 1e-15 Identities = 13/19 (68%), Positives = 15/19 (78%) Frame = +1 Query: 169 YCRGVAALT*FCQMQREGF 225 Y G++AL FCQMQREGF Sbjct: 361 YGHGLSALVRFCQMQREGF 379 >ref|XP_002268090.1| PREDICTED: pentatricopeptide repeat-containing protein At4g18750, chloroplastic-like [Vitis vinifera] Length = 529 Score = 75.1 bits (183), Expect(2) = 1e-14 Identities = 33/59 (55%), Positives = 42/59 (71%) Frame = +3 Query: 3 KLGTFELGEWIDNYVKKNGFEGNDICMSNALINMHAKCGNIKKACQVLDQMEEKALLPW 179 KL +FELGEWI YV K G ++NAL++MHAKCGNI +ACQ+ D MEEK ++ W Sbjct: 293 KLRSFELGEWISQYVVKIGLLKESPAIANALMDMHAKCGNINRACQIFDGMEEKTIVSW 351 Score = 29.3 bits (64), Expect(2) = 1e-14 Identities = 12/16 (75%), Positives = 14/16 (87%) Frame = +1 Query: 178 GVAALT*FCQMQREGF 225 G++AL FCQMQREGF Sbjct: 364 GLSALVRFCQMQREGF 379 >ref|XP_002283791.1| PREDICTED: pentatricopeptide repeat-containing protein At5g56310 [Vitis vinifera] Length = 576 Score = 65.5 bits (158), Expect = 4e-09 Identities = 30/60 (50%), Positives = 42/60 (70%) Frame = +3 Query: 6 LGTFELGEWIDNYVKKNGFEGNDICMSNALINMHAKCGNIKKACQVLDQMEEKALLPWGS 185 LG ELGEWI NY+ K+G + ++NALI+M+AKCG I+KA +V ME K+++ W S Sbjct: 284 LGALELGEWIHNYIDKHGLS-KIVPLNNALIDMYAKCGKIEKALEVFKNMEHKSVITWTS 342 >emb|CAN72397.1| hypothetical protein VITISV_041201 [Vitis vinifera] Length = 576 Score = 65.5 bits (158), Expect = 4e-09 Identities = 30/60 (50%), Positives = 42/60 (70%) Frame = +3 Query: 6 LGTFELGEWIDNYVKKNGFEGNDICMSNALINMHAKCGNIKKACQVLDQMEEKALLPWGS 185 LG ELGEWI NY+ K+G + ++NALI+M+AKCG I+KA +V ME K+++ W S Sbjct: 284 LGALELGEWIHNYIDKHGLS-KIVPLNNALIDMYAKCGKIEKALEVFKNMEHKSVITWTS 342 >ref|XP_002533966.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223526049|gb|EEF28413.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 515 Score = 62.8 bits (151), Expect = 3e-08 Identities = 25/61 (40%), Positives = 43/61 (70%) Frame = +3 Query: 3 KLGTFELGEWIDNYVKKNGFEGNDICMSNALINMHAKCGNIKKACQVLDQMEEKALLPWG 182 +LG +LG+W+ Y + NG++GN + + NALI+M+AKCGN++ A V +++K L+ W Sbjct: 371 RLGALDLGKWVHMYAQSNGYKGN-VYIGNALIDMYAKCGNVENAIVVFKSLDKKDLISWN 429 Query: 183 S 185 + Sbjct: 430 T 430