BLASTX nr result
ID: Coptis23_contig00040141
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00040141 (341 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002281711.1| PREDICTED: pentatricopeptide repeat-containi... 87 1e-15 ref|XP_002332376.1| predicted protein [Populus trichocarpa] gi|2... 69 3e-10 ref|XP_002331487.1| predicted protein [Populus trichocarpa] gi|2... 68 9e-10 ref|XP_004148898.1| PREDICTED: pentatricopeptide repeat-containi... 67 1e-09 ref|XP_003625322.1| Pentatricopeptide repeat protein [Medicago t... 65 4e-09 >ref|XP_002281711.1| PREDICTED: pentatricopeptide repeat-containing protein At2g29760, chloroplastic [Vitis vinifera] Length = 711 Score = 87.4 bits (215), Expect = 1e-15 Identities = 42/59 (71%), Positives = 47/59 (79%) Frame = +1 Query: 163 HPCLIQLEKCSNMSDLKQIHAQMLRTGYFSHVFYASQMIAFCALEDSGSLHYARLVFTQ 339 HPCL+ LEKC+ MS LKQIHAQMLRT F F AS+++AFCAL DSGSL YARLVF Q Sbjct: 41 HPCLLSLEKCTTMSQLKQIHAQMLRTCLFVDPFSASKIVAFCALHDSGSLPYARLVFNQ 99 >ref|XP_002332376.1| predicted protein [Populus trichocarpa] gi|222832200|gb|EEE70677.1| predicted protein [Populus trichocarpa] Length = 660 Score = 69.3 bits (168), Expect = 3e-10 Identities = 33/47 (70%), Positives = 40/47 (85%) Frame = +1 Query: 199 MSDLKQIHAQMLRTGYFSHVFYASQMIAFCALEDSGSLHYARLVFTQ 339 MS LKQIHAQMLRTG F F AS+++AFC+L++SGSL YARLVF+Q Sbjct: 1 MSQLKQIHAQMLRTGLFFDPFTASKIVAFCSLQESGSLQYARLVFSQ 47 >ref|XP_002331487.1| predicted protein [Populus trichocarpa] gi|222873565|gb|EEF10696.1| predicted protein [Populus trichocarpa] Length = 606 Score = 67.8 bits (164), Expect = 9e-10 Identities = 29/59 (49%), Positives = 42/59 (71%) Frame = +1 Query: 163 HPCLIQLEKCSNMSDLKQIHAQMLRTGYFSHVFYASQMIAFCALEDSGSLHYARLVFTQ 339 HP L+ +E C++M LKQI A M +T SH F S+++AFCAL DSG +++A L+F+Q Sbjct: 51 HPILLAMESCTSMLQLKQIQAHMTKTALISHTFPVSRVLAFCALSDSGDINHAHLLFSQ 109 >ref|XP_004148898.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22410, mitochondrial-like [Cucumis sativus] Length = 675 Score = 67.4 bits (163), Expect = 1e-09 Identities = 30/59 (50%), Positives = 42/59 (71%) Frame = +1 Query: 163 HPCLIQLEKCSNMSDLKQIHAQMLRTGYFSHVFYASQMIAFCALEDSGSLHYARLVFTQ 339 +P L+ L+ CS+M LKQI A + TG + +F AS+++AFCAL DSG +HYA L+F Q Sbjct: 53 NPTLLILQSCSSMFQLKQIQAHITCTGLMNQIFPASRLLAFCALSDSGDIHYAHLIFDQ 111 >ref|XP_003625322.1| Pentatricopeptide repeat protein [Medicago truncatula] gi|355500337|gb|AES81540.1| Pentatricopeptide repeat protein [Medicago truncatula] Length = 1024 Score = 65.5 bits (158), Expect = 4e-09 Identities = 30/59 (50%), Positives = 39/59 (66%) Frame = +1 Query: 163 HPCLIQLEKCSNMSDLKQIHAQMLRTGYFSHVFYASQMIAFCALEDSGSLHYARLVFTQ 339 +P L+ +E CS M LKQI A+M TG +H F S++IAFCAL SG LHYA +F + Sbjct: 158 NPTLLIMESCSTMRQLKQIQARMTLTGIITHAFPVSRVIAFCALAHSGDLHYAHTIFNR 216