BLASTX nr result
ID: Coptis23_contig00039419
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00039419 (298 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002270165.1| PREDICTED: disease resistance protein At4g27... 55 6e-06 >ref|XP_002270165.1| PREDICTED: disease resistance protein At4g27190-like [Vitis vinifera] Length = 982 Score = 55.1 bits (131), Expect = 6e-06 Identities = 26/60 (43%), Positives = 40/60 (66%) Frame = -1 Query: 295 SWPSLEHITVEYCVHLRSFPLDTNSVPKLKQFDVDLKWFKRLECADDRIKTRLFQTFFPE 116 SWPS+E +TV C HL+ PL+ SV +K+ +L+W++RLE D+ +++ L Q FF E Sbjct: 915 SWPSIEELTVNDCDHLKRLPLNRQSVNIIKKIRGELEWWRRLEWGDEEMRSSL-QPFFLE 973