BLASTX nr result
ID: Coptis23_contig00039395
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00039395 (289 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002321637.1| predicted protein [Populus trichocarpa] gi|2... 65 6e-09 ref|XP_002511307.1| conserved hypothetical protein [Ricinus comm... 64 1e-08 >ref|XP_002321637.1| predicted protein [Populus trichocarpa] gi|222868633|gb|EEF05764.1| predicted protein [Populus trichocarpa] Length = 657 Score = 65.1 bits (157), Expect = 6e-09 Identities = 35/56 (62%), Positives = 40/56 (71%) Frame = -2 Query: 195 RHRSVESFSDEILSKSAKHSRNKSETVFESQPQLDAAVEISPASAVHQWFSNILKP 28 RHRS E+FS EIL+KSAKHSRNKSE++ E+ E SPAS WFSNILKP Sbjct: 141 RHRSKEAFSGEILTKSAKHSRNKSESLVET------PAEPSPASQFQGWFSNILKP 190 >ref|XP_002511307.1| conserved hypothetical protein [Ricinus communis] gi|223550422|gb|EEF51909.1| conserved hypothetical protein [Ricinus communis] Length = 648 Score = 63.9 bits (154), Expect = 1e-08 Identities = 37/65 (56%), Positives = 45/65 (69%) Frame = -2 Query: 195 RHRSVESFSDEILSKSAKHSRNKSETVFESQPQLDAAVEISPASAVHQWFSNILKPHHHV 16 RHR+VE FS EIL KSAKH RNKSE++ ++ P + E SPAS V +WFSNILKP + Sbjct: 138 RHRAVEGFSGEILIKSAKHIRNKSESL-DNLP--ISPSEPSPASQVQEWFSNILKPSNPN 194 Query: 15 PQDSN 1 SN Sbjct: 195 TNQSN 199