BLASTX nr result
ID: Coptis23_contig00039343
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00039343 (271 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003579419.1| PREDICTED: G-type lectin S-receptor-like ser... 57 1e-06 >ref|XP_003579419.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein kinase At1g34300-like [Brachypodium distachyon] Length = 372 Score = 57.4 bits (137), Expect = 1e-06 Identities = 24/33 (72%), Positives = 27/33 (81%) Frame = -2 Query: 270 WCVQYMPGDRPSMRDVVRLLEGREEVMTPPNPF 172 WCVQY P DRPSM +VVR+LEG EE+ TP NPF Sbjct: 321 WCVQYRPEDRPSMGNVVRMLEGEEEIATPGNPF 353