BLASTX nr result
ID: Coptis23_contig00039240
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00039240 (291 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002519948.1| conserved hypothetical protein [Ricinus comm... 58 9e-07 ref|XP_002329190.1| predicted protein [Populus trichocarpa] gi|2... 57 2e-06 >ref|XP_002519948.1| conserved hypothetical protein [Ricinus communis] gi|223540994|gb|EEF42552.1| conserved hypothetical protein [Ricinus communis] Length = 140 Score = 57.8 bits (138), Expect = 9e-07 Identities = 22/31 (70%), Positives = 27/31 (87%) Frame = +3 Query: 33 GYGVGRGVAHDESRRYTNIGKLFHGPGYLPS 125 GYG+GRGVAHD+ RRY+N+ K FHGPG LP+ Sbjct: 79 GYGIGRGVAHDDKRRYSNVAKFFHGPGNLPT 109 >ref|XP_002329190.1| predicted protein [Populus trichocarpa] gi|222870971|gb|EEF08102.1| predicted protein [Populus trichocarpa] Length = 141 Score = 57.0 bits (136), Expect = 2e-06 Identities = 24/32 (75%), Positives = 27/32 (84%) Frame = +3 Query: 33 GYGVGRGVAHDESRRYTNIGKLFHGPGYLPSH 128 GYGVGRGVAHDE RRY+N+GK F GP LP+H Sbjct: 80 GYGVGRGVAHDEKRRYSNVGKHFRGPVNLPTH 111