BLASTX nr result
ID: Coptis23_contig00038857
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00038857 (276 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004155090.1| PREDICTED: LETM1 and EF-hand domain-containi... 87 1e-15 ref|XP_004152837.1| PREDICTED: LETM1 and EF-hand domain-containi... 87 1e-15 ref|XP_002514773.1| leucine zipper-ef-hand containing transmembr... 87 1e-15 emb|CAN67346.1| hypothetical protein VITISV_030338 [Vitis vinifera] 87 1e-15 gb|AAB60908.1| Similar to Saccharomyces hypothetical protein P96... 86 4e-15 >ref|XP_004155090.1| PREDICTED: LETM1 and EF-hand domain-containing protein 1, mitochondrial-like [Cucumis sativus] Length = 756 Score = 87.0 bits (214), Expect = 1e-15 Identities = 38/52 (73%), Positives = 42/52 (80%) Frame = -2 Query: 158 R*DWMNKSRHWKDEFKSAMQHYWAGTKLIWLDIRISYRLLLKLACGRSLSRR 3 R DW K RHWKDEFKS MQHYW GTKL+W D+RIS RLL+KLA G+ LSRR Sbjct: 198 REDWAKKLRHWKDEFKSTMQHYWLGTKLLWADVRISSRLLVKLASGKGLSRR 249 >ref|XP_004152837.1| PREDICTED: LETM1 and EF-hand domain-containing protein 1, mitochondrial-like [Cucumis sativus] Length = 746 Score = 87.0 bits (214), Expect = 1e-15 Identities = 38/52 (73%), Positives = 42/52 (80%) Frame = -2 Query: 158 R*DWMNKSRHWKDEFKSAMQHYWAGTKLIWLDIRISYRLLLKLACGRSLSRR 3 R DW K RHWKDEFKS MQHYW GTKL+W D+RIS RLL+KLA G+ LSRR Sbjct: 198 REDWAKKLRHWKDEFKSTMQHYWLGTKLLWADVRISSRLLVKLASGKGLSRR 249 >ref|XP_002514773.1| leucine zipper-ef-hand containing transmembrane protein, putative [Ricinus communis] gi|223545824|gb|EEF47327.1| leucine zipper-ef-hand containing transmembrane protein, putative [Ricinus communis] Length = 758 Score = 87.0 bits (214), Expect = 1e-15 Identities = 38/52 (73%), Positives = 42/52 (80%) Frame = -2 Query: 158 R*DWMNKSRHWKDEFKSAMQHYWAGTKLIWLDIRISYRLLLKLACGRSLSRR 3 R DW K RHWKDEFKS MQHYW GTKL+W D+RIS RLL+KLA G+ LSRR Sbjct: 198 REDWAKKLRHWKDEFKSTMQHYWLGTKLLWADVRISSRLLVKLASGKGLSRR 249 >emb|CAN67346.1| hypothetical protein VITISV_030338 [Vitis vinifera] Length = 480 Score = 87.0 bits (214), Expect = 1e-15 Identities = 39/52 (75%), Positives = 42/52 (80%) Frame = -2 Query: 158 R*DWMNKSRHWKDEFKSAMQHYWAGTKLIWLDIRISYRLLLKLACGRSLSRR 3 R DW K HWKDEFKS MQHYW GTKL+W D+RIS RLLLKLA G+SLSRR Sbjct: 200 REDWAKKLSHWKDEFKSTMQHYWLGTKLLWADVRISLRLLLKLAGGKSLSRR 251 >gb|AAB60908.1| Similar to Saccharomyces hypothetical protein P9642.2 (gb|U40828) [Arabidopsis thaliana] Length = 398 Score = 85.5 bits (210), Expect = 4e-15 Identities = 37/52 (71%), Positives = 42/52 (80%) Frame = -2 Query: 158 R*DWMNKSRHWKDEFKSAMQHYWAGTKLIWLDIRISYRLLLKLACGRSLSRR 3 R DW K RHWKDEFKS +QHYW GTKL+W D+RIS RLL+KLA G+ LSRR Sbjct: 120 REDWAKKLRHWKDEFKSTLQHYWLGTKLLWADVRISVRLLVKLANGKGLSRR 171