BLASTX nr result
ID: Coptis23_contig00038550
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00038550 (333 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN69109.1| hypothetical protein VITISV_025716 [Vitis vinifera] 51 3e-07 >emb|CAN69109.1| hypothetical protein VITISV_025716 [Vitis vinifera] Length = 1241 Score = 50.8 bits (120), Expect(2) = 3e-07 Identities = 24/45 (53%), Positives = 29/45 (64%), Gaps = 2/45 (4%) Frame = +3 Query: 15 ERDNLWRKVIVS*FGESHLGWLSGLVTSPY--GVWKGILKVWEEF 143 ER++ WRKVIV FGE GW + +V Y G+WK I K WEEF Sbjct: 458 ERESFWRKVIVGKFGEEEGGWTTRVVRESYGMGLWKDIKKGWEEF 502 Score = 28.5 bits (62), Expect(2) = 3e-07 Identities = 12/53 (22%), Positives = 27/53 (50%) Frame = +1 Query: 172 WNMGIDTTLPNKDIVSVVALTDMLESIPPVRPDKDKRLWAINNKGKFSIRSWY 330 W + + + ++ V D + ++ V+ +D W I +GKF+++S+Y Sbjct: 538 WEVHFRRSFQDWELEEVTRFLDHIXAVK-VQEWEDSLFWKIERRGKFNVKSYY 589