BLASTX nr result
ID: Coptis23_contig00037922
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00037922 (221 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002327057.1| predicted protein [Populus trichocarpa] gi|2... 105 5e-21 ref|XP_002274957.1| PREDICTED: FKBP-type peptidyl-prolyl cis-tra... 104 9e-21 ref|XP_002511603.1| fk506-binding protein, putative [Ricinus com... 103 1e-20 ref|NP_001236089.1| uncharacterized protein LOC100305486 [Glycin... 102 4e-20 ref|XP_003529043.1| PREDICTED: FKBP-type peptidyl-prolyl cis-tra... 101 7e-20 >ref|XP_002327057.1| predicted protein [Populus trichocarpa] gi|222835372|gb|EEE73807.1| predicted protein [Populus trichocarpa] Length = 210 Score = 105 bits (261), Expect = 5e-21 Identities = 47/51 (92%), Positives = 51/51 (100%) Frame = +3 Query: 69 QVTFHYVGYNESGRRIDSTYLQGAPAKIRMGTNSLVPGFEEGIRDMKPGGK 221 QVTFHYVGYNESGRRIDSTYLQG+PAKIRMGTN+L+PGFEEGIRDM+PGGK Sbjct: 109 QVTFHYVGYNESGRRIDSTYLQGSPAKIRMGTNALIPGFEEGIRDMRPGGK 159 >ref|XP_002274957.1| PREDICTED: FKBP-type peptidyl-prolyl cis-trans isomerase 6, chloroplastic [Vitis vinifera] gi|297734593|emb|CBI16644.3| unnamed protein product [Vitis vinifera] Length = 258 Score = 104 bits (259), Expect = 9e-21 Identities = 47/51 (92%), Positives = 51/51 (100%) Frame = +3 Query: 69 QVTFHYVGYNESGRRIDSTYLQGAPAKIRMGTNSLVPGFEEGIRDMKPGGK 221 QVTFHYVGYNESGRRIDS+Y+QG+PAKIRMGTN+LVPGFEEGIRDMKPGGK Sbjct: 157 QVTFHYVGYNESGRRIDSSYMQGSPAKIRMGTNALVPGFEEGIRDMKPGGK 207 >ref|XP_002511603.1| fk506-binding protein, putative [Ricinus communis] gi|223548783|gb|EEF50272.1| fk506-binding protein, putative [Ricinus communis] Length = 265 Score = 103 bits (258), Expect = 1e-20 Identities = 48/51 (94%), Positives = 50/51 (98%) Frame = +3 Query: 69 QVTFHYVGYNESGRRIDSTYLQGAPAKIRMGTNSLVPGFEEGIRDMKPGGK 221 QVTFHYVGYNESGRRIDSTYLQGAPAKIRMGTN+LVPGFEEGI DM+PGGK Sbjct: 157 QVTFHYVGYNESGRRIDSTYLQGAPAKIRMGTNALVPGFEEGIGDMRPGGK 207 >ref|NP_001236089.1| uncharacterized protein LOC100305486 [Glycine max] gi|255625657|gb|ACU13173.1| unknown [Glycine max] Length = 248 Score = 102 bits (253), Expect = 4e-20 Identities = 46/51 (90%), Positives = 48/51 (94%) Frame = +3 Query: 69 QVTFHYVGYNESGRRIDSTYLQGAPAKIRMGTNSLVPGFEEGIRDMKPGGK 221 QVTFHY+GYNESGRRIDSTYLQG PAKIRMGT LVPGFEEGIRDM+PGGK Sbjct: 147 QVTFHYIGYNESGRRIDSTYLQGTPAKIRMGTKGLVPGFEEGIRDMRPGGK 197 >ref|XP_003529043.1| PREDICTED: FKBP-type peptidyl-prolyl cis-trans isomerase 6, chloroplastic-like [Glycine max] Length = 248 Score = 101 bits (251), Expect = 7e-20 Identities = 45/51 (88%), Positives = 49/51 (96%) Frame = +3 Query: 69 QVTFHYVGYNESGRRIDSTYLQGAPAKIRMGTNSLVPGFEEGIRDMKPGGK 221 QVTFHY+GYNESGRRIDSTYLQG+PAKIRMGT LVPGFEEGI+DM+PGGK Sbjct: 147 QVTFHYIGYNESGRRIDSTYLQGSPAKIRMGTKGLVPGFEEGIKDMRPGGK 197