BLASTX nr result
ID: Coptis23_contig00037903
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00037903 (414 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004154718.1| PREDICTED: probable inactive leucine-rich re... 83 3e-14 ref|XP_004150163.1| PREDICTED: probable inactive leucine-rich re... 83 3e-14 ref|XP_002534272.1| ATP binding protein, putative [Ricinus commu... 81 8e-14 ref|XP_002277291.2| PREDICTED: probable inactive leucine-rich re... 79 4e-13 emb|CBI29900.3| unnamed protein product [Vitis vinifera] 79 4e-13 >ref|XP_004154718.1| PREDICTED: probable inactive leucine-rich repeat receptor-like protein kinase At1g66830-like [Cucumis sativus] Length = 650 Score = 82.8 bits (203), Expect = 3e-14 Identities = 42/84 (50%), Positives = 50/84 (59%) Frame = -3 Query: 253 LNSDGLTLLALKSAISKDPAHYLDTWFESDTTPCKWVGIKCNNHNKQVTHLLLSNKSFNG 74 LNSDGL+LLALK+AI DP+H L++W E D+TPC W GI C +VT L L NK G Sbjct: 23 LNSDGLSLLALKAAIESDPSHVLESWSEFDSTPCHWPGIVCT--RDRVTQLSLPNKGLTG 80 Query: 73 YIPXXXXXXXXXXXXXXSFNNFPK 2 YIP +FNNF K Sbjct: 81 YIPSELGLLDSLRRLSLAFNNFSK 104 >ref|XP_004150163.1| PREDICTED: probable inactive leucine-rich repeat receptor-like protein kinase At1g66830-like [Cucumis sativus] Length = 650 Score = 82.8 bits (203), Expect = 3e-14 Identities = 42/84 (50%), Positives = 50/84 (59%) Frame = -3 Query: 253 LNSDGLTLLALKSAISKDPAHYLDTWFESDTTPCKWVGIKCNNHNKQVTHLLLSNKSFNG 74 LNSDGL+LLALK+AI DP+H L++W E D+TPC W GI C +VT L L NK G Sbjct: 23 LNSDGLSLLALKAAIESDPSHVLESWSEFDSTPCHWPGIVCT--RDRVTQLSLPNKGLTG 80 Query: 73 YIPXXXXXXXXXXXXXXSFNNFPK 2 YIP +FNNF K Sbjct: 81 YIPSELGLLDSLRRLSLAFNNFSK 104 >ref|XP_002534272.1| ATP binding protein, putative [Ricinus communis] gi|223525595|gb|EEF28109.1| ATP binding protein, putative [Ricinus communis] Length = 654 Score = 81.3 bits (199), Expect = 8e-14 Identities = 42/82 (51%), Positives = 49/82 (59%) Frame = -3 Query: 253 LNSDGLTLLALKSAISKDPAHYLDTWFESDTTPCKWVGIKCNNHNKQVTHLLLSNKSFNG 74 L DGL LLALK+AI+ DP LD+W +SD TPC W GI C NH +VT L+L NKSF G Sbjct: 23 LTRDGLALLALKAAITTDPTRVLDSWSDSDQTPCHWHGITCINH--RVTSLILPNKSFTG 80 Query: 73 YIPXXXXXXXXXXXXXXSFNNF 8 Y+P S NNF Sbjct: 81 YLPSELGLLDSLTRLTLSHNNF 102 >ref|XP_002277291.2| PREDICTED: probable inactive leucine-rich repeat receptor-like protein kinase At1g66830-like [Vitis vinifera] Length = 640 Score = 79.0 bits (193), Expect = 4e-13 Identities = 42/84 (50%), Positives = 49/84 (58%) Frame = -3 Query: 253 LNSDGLTLLALKSAISKDPAHYLDTWFESDTTPCKWVGIKCNNHNKQVTHLLLSNKSFNG 74 LNSDGL+LLALK+AI DP LDTW ESD PC W GI C + +VT + L N+SF G Sbjct: 24 LNSDGLSLLALKAAIVSDPTGVLDTWSESDLVPCHWGGISCT--HGRVTGVFLPNRSFTG 81 Query: 73 YIPXXXXXXXXXXXXXXSFNNFPK 2 YIP + NNF K Sbjct: 82 YIPSELGALVNLRQLSLANNNFSK 105 >emb|CBI29900.3| unnamed protein product [Vitis vinifera] Length = 739 Score = 79.0 bits (193), Expect = 4e-13 Identities = 42/84 (50%), Positives = 49/84 (58%) Frame = -3 Query: 253 LNSDGLTLLALKSAISKDPAHYLDTWFESDTTPCKWVGIKCNNHNKQVTHLLLSNKSFNG 74 LNSDGL+LLALK+AI DP LDTW ESD PC W GI C + +VT + L N+SF G Sbjct: 123 LNSDGLSLLALKAAIVSDPTGVLDTWSESDLVPCHWGGISCT--HGRVTGVFLPNRSFTG 180 Query: 73 YIPXXXXXXXXXXXXXXSFNNFPK 2 YIP + NNF K Sbjct: 181 YIPSELGALVNLRQLSLANNNFSK 204