BLASTX nr result
ID: Coptis23_contig00037896
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00037896 (492 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004153549.1| PREDICTED: S-adenosylmethionine decarboxylas... 75 6e-12 ref|XP_004145040.1| PREDICTED: S-adenosylmethionine decarboxylas... 75 6e-12 ref|XP_004167626.1| PREDICTED: LOW QUALITY PROTEIN: S-adenosylme... 73 3e-11 ref|XP_004134166.1| PREDICTED: S-adenosylmethionine decarboxylas... 73 3e-11 emb|CBI26155.3| unnamed protein product [Vitis vinifera] 71 1e-10 >ref|XP_004153549.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme 2-like [Cucumis sativus] Length = 348 Score = 75.1 bits (183), Expect = 6e-12 Identities = 36/52 (69%), Positives = 41/52 (78%) Frame = +1 Query: 1 MSVSTTGAANEDVCTPVRDVLQPLGLKCRSCTMDEFPSAGNVVFQTFTTRRK 156 +SVSTT A + V V L+PLGLKCRSCT+DEFP+ GNVVFQTFTTRRK Sbjct: 288 VSVSTTTATSHRVWARVAGALEPLGLKCRSCTVDEFPAVGNVVFQTFTTRRK 339 >ref|XP_004145040.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme 2-like, partial [Cucumis sativus] gi|449516677|ref|XP_004165373.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme 2-like, partial [Cucumis sativus] Length = 351 Score = 75.1 bits (183), Expect = 6e-12 Identities = 36/52 (69%), Positives = 41/52 (78%) Frame = +1 Query: 1 MSVSTTGAANEDVCTPVRDVLQPLGLKCRSCTMDEFPSAGNVVFQTFTTRRK 156 +SVSTT A + V V L+PLGLKCRSCT+DEFP+ GNVVFQTFTTRRK Sbjct: 291 VSVSTTTATSHRVWARVAGALEPLGLKCRSCTVDEFPAVGNVVFQTFTTRRK 342 >ref|XP_004167626.1| PREDICTED: LOW QUALITY PROTEIN: S-adenosylmethionine decarboxylase proenzyme 1-like [Cucumis sativus] Length = 340 Score = 72.8 bits (177), Expect = 3e-11 Identities = 37/52 (71%), Positives = 42/52 (80%) Frame = +1 Query: 1 MSVSTTGAANEDVCTPVRDVLQPLGLKCRSCTMDEFPSAGNVVFQTFTTRRK 156 MSV+TTGA++E V V L PLGLKCRSC +DEFPSAG+VVFQTFT RRK Sbjct: 290 MSVATTGASHE-VWALVAGALDPLGLKCRSCAVDEFPSAGSVVFQTFTARRK 340 >ref|XP_004134166.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme 1-like [Cucumis sativus] Length = 340 Score = 72.8 bits (177), Expect = 3e-11 Identities = 37/52 (71%), Positives = 42/52 (80%) Frame = +1 Query: 1 MSVSTTGAANEDVCTPVRDVLQPLGLKCRSCTMDEFPSAGNVVFQTFTTRRK 156 MSV+TTGA++E V V L PLGLKCRSC +DEFPSAG+VVFQTFT RRK Sbjct: 290 MSVATTGASHE-VWALVAGALDPLGLKCRSCAVDEFPSAGSVVFQTFTARRK 340 >emb|CBI26155.3| unnamed protein product [Vitis vinifera] Length = 335 Score = 70.9 bits (172), Expect = 1e-10 Identities = 35/52 (67%), Positives = 43/52 (82%) Frame = +1 Query: 1 MSVSTTGAANEDVCTPVRDVLQPLGLKCRSCTMDEFPSAGNVVFQTFTTRRK 156 MSVSTT ++E V T V L+P+GLKCRSC +DEFP+AG++VFQTFTTRRK Sbjct: 263 MSVSTTCTSHE-VWTRVATALEPMGLKCRSCAVDEFPAAGSMVFQTFTTRRK 313