BLASTX nr result
ID: Coptis23_contig00037638
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00037638 (279 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002530358.1| conserved hypothetical protein [Ricinus comm... 60 1e-10 ref|XP_002317716.1| predicted protein [Populus trichocarpa] gi|2... 46 4e-06 emb|CAN64638.1| hypothetical protein VITISV_033929 [Vitis vinifera] 53 8e-06 >ref|XP_002530358.1| conserved hypothetical protein [Ricinus communis] gi|223530105|gb|EEF32019.1| conserved hypothetical protein [Ricinus communis] Length = 912 Score = 60.1 bits (144), Expect(2) = 1e-10 Identities = 22/55 (40%), Positives = 37/55 (67%) Frame = +1 Query: 88 PLSAPDRTVASYVSNFCKALYAWELPSEISISGKQCKCGGCVLGQVISSERLPEW 252 PL ++AS +S K+ YAWELPS++ +SG++C+CG C++ + + LP+W Sbjct: 428 PLPGQQGSIASEISKISKSAYAWELPSDLLLSGEECQCGSCLVKEEFLKDALPDW 482 Score = 30.8 bits (68), Expect(2) = 1e-10 Identities = 12/18 (66%), Positives = 15/18 (83%) Frame = +2 Query: 8 YKWATVSGFGILLGSVLN 61 ++WAT SGFGI+LGS N Sbjct: 400 HEWATTSGFGIILGSFWN 417 >ref|XP_002317716.1| predicted protein [Populus trichocarpa] gi|222858389|gb|EEE95936.1| predicted protein [Populus trichocarpa] Length = 906 Score = 45.8 bits (107), Expect(2) = 4e-06 Identities = 18/43 (41%), Positives = 26/43 (60%) Frame = +1 Query: 124 VSNFCKALYAWELPSEISISGKQCKCGGCVLGQVISSERLPEW 252 +S F LYAW+ PS + +SG C+ G C++ + E LPEW Sbjct: 444 ISKFSSCLYAWDHPSGLMLSGDDCQRGDCLVREQFWKEALPEW 486 Score = 29.6 bits (65), Expect(2) = 4e-06 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = +2 Query: 2 DNYKWATVSGFGILLGSVLN 61 D + WA SGFGI+LGS N Sbjct: 402 DTHDWANSSGFGIILGSFWN 421 >emb|CAN64638.1| hypothetical protein VITISV_033929 [Vitis vinifera] Length = 865 Score = 53.1 bits (126), Expect(2) = 8e-06 Identities = 22/51 (43%), Positives = 30/51 (58%) Frame = +1 Query: 100 PDRTVASYVSNFCKALYAWELPSEISISGKQCKCGGCVLGQVISSERLPEW 252 P + A +S CK+ YAWELPSE+S+ G +C CG C+ + LP W Sbjct: 384 PKGSTAYEISKLCKSYYAWELPSELSLLGNECFCGTCLSRKEFLKGTLPVW 434 Score = 21.2 bits (43), Expect(2) = 8e-06 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +2 Query: 2 DNYKWATVSGFGILLGS 52 D YK A+ S F I++GS Sbjct: 350 DKYKEASESAFCIIMGS 366