BLASTX nr result
ID: Coptis23_contig00037440
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00037440 (481 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI18982.3| unnamed protein product [Vitis vinifera] 77 1e-12 ref|XP_002284567.1| PREDICTED: cyclin-A1-1-like [Vitis vinifera] 77 1e-12 ref|XP_002520329.1| cyclin A, putative [Ricinus communis] gi|223... 74 2e-11 ref|XP_002306649.1| predicted protein [Populus trichocarpa] gi|2... 72 5e-11 dbj|BAE06271.1| cyclin A [Scutellaria baicalensis] 69 5e-10 >emb|CBI18982.3| unnamed protein product [Vitis vinifera] Length = 550 Score = 77.4 bits (189), Expect = 1e-12 Identities = 34/37 (91%), Positives = 37/37 (100%) Frame = +1 Query: 1 HNTSLPAIREKYSQHKYKFVAKKYCPPSIPSELFYDL 111 HN+SLPAIREKYSQHKYKFVAKKYCPPSIPSELF++L Sbjct: 512 HNSSLPAIREKYSQHKYKFVAKKYCPPSIPSELFHNL 548 >ref|XP_002284567.1| PREDICTED: cyclin-A1-1-like [Vitis vinifera] Length = 495 Score = 77.4 bits (189), Expect = 1e-12 Identities = 34/37 (91%), Positives = 37/37 (100%) Frame = +1 Query: 1 HNTSLPAIREKYSQHKYKFVAKKYCPPSIPSELFYDL 111 HN+SLPAIREKYSQHKYKFVAKKYCPPSIPSELF++L Sbjct: 457 HNSSLPAIREKYSQHKYKFVAKKYCPPSIPSELFHNL 493 >ref|XP_002520329.1| cyclin A, putative [Ricinus communis] gi|223540548|gb|EEF42115.1| cyclin A, putative [Ricinus communis] Length = 498 Score = 73.6 bits (179), Expect = 2e-11 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = +1 Query: 1 HNTSLPAIREKYSQHKYKFVAKKYCPPSIPSELFYD 108 HN++LPAIREKYSQHKYKFVAKKYCPPSIP E F+D Sbjct: 460 HNSTLPAIREKYSQHKYKFVAKKYCPPSIPQEFFHD 495 >ref|XP_002306649.1| predicted protein [Populus trichocarpa] gi|222856098|gb|EEE93645.1| predicted protein [Populus trichocarpa] Length = 493 Score = 72.0 bits (175), Expect = 5e-11 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = +1 Query: 1 HNTSLPAIREKYSQHKYKFVAKKYCPPSIPSELFYDL 111 HN++LPAIREKYSQHKYKFVAKKYCPPSIP E F +L Sbjct: 455 HNSTLPAIREKYSQHKYKFVAKKYCPPSIPEEFFQNL 491 >dbj|BAE06271.1| cyclin A [Scutellaria baicalensis] Length = 496 Score = 68.6 bits (166), Expect = 5e-10 Identities = 30/37 (81%), Positives = 34/37 (91%) Frame = +1 Query: 1 HNTSLPAIREKYSQHKYKFVAKKYCPPSIPSELFYDL 111 HN+SLPAIREKYSQHKYKFVAKKYCP SIP E F+++ Sbjct: 458 HNSSLPAIREKYSQHKYKFVAKKYCPLSIPPEYFHNV 494